Citrus Sinensis ID: 016004


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MSNIVVLDNGGGLIKAGHGGERDPAVTIPNCMYRPLSSKKFIHPSPTAASATEDLTSAAVRRPIDRGYLINSDLQRDIWAHLFSSLLHISPSASSLLLTEPLFALPSIQRATDELVFEDFNFKSLFVADPPSLVHLYEASRRPYGLLSETQCSLVVDCGFSFTHAAPVFQNFTVNYAVKRIDLGGKALTNYLKELVSYRAINVMDETFIIDDVKEKLCFVSLDVARDLQIARKRGKDNLLRCTYVLPDGVTHTKGFVKDPDAAQRYLSLSDGSRSQPSETVKDMDRTEVMEEARDRKRADLAKNEFDLTNERFLVPEMIFQPADLGMNQAGLAECIVRAVNSCHPYLHSVLYESIILTGGSTLFPRFAERLERELRPLVPDDYQVKITTQEEYSHPP
cccEEEEEcccccEEEECcccccccCEEECcCECccccCEEEccccccHHHccccccEECccccccccccccHHHHHHHHHHHHHccccccccccEEECccccccHHHHHHHHcHHcccccccEEEEEcHHHHHHHHHcccccccccccccCEEEEEcccccCEEEcccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccHHHHHHHHHHccccccCEEEEEcccccEEEEcccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHccEEEcccccccccHHHHHHHHHcccccccccCEEEccccccccc
MSNIVVLDNGGGLIKAGHGGERDPAVTIPNCMYRPLSSKKFIHPSPTAASATEDLTSAAVRRPIDRGYLINSDLQRDIWAHLFSSLLHISPSASSLLLTEPLFALPSIQRATDELVFEDFNFKSLFVADPPSLVHLYEASRRPYGLLSETQCSLVVDCGFSFTHAAPVFQNFTVNYAVKRIDLGGKALTNYLKELVSYRAINVMDETFIIDDVKEKLCFVSLDVARDLQIARKRGKDNLLRCTYVLPDGVTHTKGFVKDPDAAQRYLSLS***********KDMDRTEVMEEARDRKRADLAKNEFDLTNERFLVPEMIFQPADLGMNQAGLAECIVRAVNSCHPYLHSVLYESIILTGGSTLFPRFAERLERELRPLVPDDYQVKITTQEE*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNIVVLDNGGGLIKAGHGGERDPAVTIPNCMYRPLSSKKFIHPSPTAASATEDLTSAAVRRPIDRGYLINSDLQRDIWAHLFSSLLHISPSASSLLLTEPLFALPSIQRATDELVFEDFNFKSLFVADPPSLVHLYEASRRPYGLLSETQCSLVVDCGFSFTHAAPVFQNFTVNYAVKRIDLGGKALTNYLKELVSYRAINVMDETFIIDDVKEKLCFVSLDVARDLQIARKRGKDNLLRCTYVLPDGVTHTKGFVKDPDAAQRYLSLSDGSRSQPSETVKDMDRTEVMEEARDRKRADLAKNEFDLTNERFLVPEMIFQPADLGMNQAGLAECIVRAVNSCHPYLHSVLYESIILTGGSTLFPRFAERLERELRPLVPDDYQVKITTQEEYSHPP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-related protein 6 Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant H2A.F/Z leading to transcriptional regulation of selected genes (e.g. FLC) by chromatin remodeling. Required for the activation of FLC and FLC/MAF genes expression to levels that inhibit flowering, through both histone H3 and H4 acetylation and methylation mechanisms. Involved in several developmental processes including organization of plant organs, leaves formation, flowering time repression, and fertility. Modulates photoperiod-dependent epidermal leaves cell development; promotes cell division in long days, and cell expansion/division in short days. May be involved in the regulation of pathogenesis-related proteins (PRs).confidentQ8LGE3
Actin-related protein 6 Component of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant H2A.F/Z leading to transcriptional regulation of selected genes by chromatin remodeling. Involved in several developmental processes. May be involved in the regulation of pathogenesis-related proteins (PRs).probableQ5NBI2
Actin-related protein 6 probableQ9GZN1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1K8K, chain A
Confidence level:very confident
Coverage over the Query: 2-252,302-396
View the alignment between query and template
View the model in PyMOL
Template: 4FO0, chain A
Confidence level:confident
Coverage over the Query: 2-227,238-283
View the alignment between query and template
View the model in PyMOL