Citrus Sinensis ID: 016007

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MGSRSFSPPITILVLVLLNFTPCLALAKTSQCKFPAIFNFGDSNSDTGGLSAVFGQAGPPHGMSFFGGPAGRYCDGRLIVDFIAEAFGLPYVSAYLDSIGSDFSHGANFATAGSTVRPQNTTLRESGFSPISLDVQWNEFYDFHRRSQIVRNHSGAYQKLLPDLDAALKRLPKAEDFPNALYTFDIGQNDLTAGYFANMTTDQVKAYVPEVVTQLQNVIRYIYGLGGRYFWIHNTGPVGCLPYVLERIPVLASQVDEAGCATPFNDVAKYFNSQLKQAVVQLRKDLPSAALTYVDVYSVKYALFHQPQKHGFKQSIRNCCGRGGRYNYNINVGCGQTKMEHGKQVLLGKPCDDPSGYVVWDGVHFTQAANKFIFQQTAGGAYSDPPIPLNMACHRIE
cccccccHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHcHHHHHHcccccHHcccccEEEEEEccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccHHHHHHHHHHHHHHccccccccccccccccccc
******S*PITILVLVLLNFTPCLALAKTSQCKFPAIFNFGDSNSDTGGLSAVFGQAGPPHGMSFFGGPAGRYCDGRLIVDFIAEAFGLPYVSAYLDSIGSDFSHGANFATAGSTVRPQNTTLRESGFSPISLDVQWNEFYDFHRRSQIVRNHSGAYQKLLPDLDAALKRLPKAEDFPNALYTFDIGQNDLTAGYFANMTTDQVKAYVPEVVTQLQNVIRYIYGLGGRYFWIHNTGPVGCLPYVLERIPVLASQVDEAGCATPFNDVAKYFNSQLKQAVVQLRKDLPSAALTYVDVYSVKYALFHQPQKHGFKQSIRNCCGRGGRYNYNINVGCGQTKMEHGKQVLLGKPCDDPSGYVVWDGVHFTQAANKFIFQQTAGGAYSDPPIPLNMACH***
xxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSRSFSPPITILVLVLLNFTPCLALAKTSQCKFPAIFNFGDSNSDTGGLSAVFGQAGPPHGMSFFGGPAGRYCDGRLIVDFIAEAFGLPYVSAYLDSIGSDFSHGANFATAGSTVRPQNTTLRESGFSPISLDVQWNEFYDFHRRSQIVRNHSGAYQKLLPDLDAALKRLPKAEDFPNALYTFDIGQNDLTAGYFANMTTDQVKAYVPEVVTQLQNVIRYIYGLGGRYFWIHNTGPVGCLPYVLERIPVLASQVDEAGCATPFNDVAKYFNSQLKQAVVQLRKDLPSAALTYVDVYSVKYALFHQPQKHGFKQSIRNCCGRGGRYNYNINVGCGQTKMEHGKQVLLGKPCDDPSGYVVWDGVHFTQAANKFIFQQTAGGAYSDPPIPLNMACHRIE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-L-fucosidase 3 Hydrolyzes alpha-1,2-linked fucose. Also active on fucosylated xyloglucan oligosaccharides.probableQ9FXE5
Esterase Has lipase and esterase activities. May be involved in plant defense.probableQ7Y1X1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KVN, chain X
Confidence level:very confident
Coverage over the Query: 30-149,172-245,257-380
View the alignment between query and template
View the model in PyMOL