BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016012
         (397 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1IRZ|A Chain A, Solution Structure Of Arr10-B Belonging To The Garp Family
           Of Plant Myb-Related Dna Binding Motifs Of The
           Arabidopsis Response Regulators
          Length = 64

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 244 SMRAPRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYR 300
           + + PR+ WT  LH +F+ AV+ LG  ERA PK +L+LM+V  LT  +V SHLQ +R
Sbjct: 2   AQKKPRVLWTHELHNKFLAAVDHLGV-ERAVPKKILDLMNVDKLTRENVASHLQKFR 57


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.129    0.382 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,873,025
Number of Sequences: 62578
Number of extensions: 243586
Number of successful extensions: 445
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 442
Number of HSP's gapped (non-prelim): 2
length of query: 397
length of database: 14,973,337
effective HSP length: 101
effective length of query: 296
effective length of database: 8,652,959
effective search space: 2561275864
effective search space used: 2561275864
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)