Citrus Sinensis ID: 016012


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------
MELFPAQPDLSLQISPPNSKPSSTWSSRRGAAAEEEMDLGFWKRALDSRNSSSMAAANAKPSSDISTGGGFELSLSNPARVSSSSVLSESLSSNNNLNHHHQFHLLQNNTTTTTNCNGNNIFHSFHHQQNHSQFPTHHHLHQNQHHHPVLYHQPPQQQGLSQELGFLRPIRGIPVYQNPHHHHHHHQASHAFPFPHHQQQPLDSPPPPSLVANNNTSTSSLNSFQSQQGLMRSRFMSRFPAKRSMRAPRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVKTTDRAAASSGQSDAFENGSSGDTSEDIMFGIQHPRRPETSSIQQQGRASNGLWSNSSSREAWLHGKTKDSAINLPSLEEVDPKCMSYEGISDGS
cccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHccccccHHHHHHHHHHHHHccccccHHcccccccccccccccccccHHcccccccccccccHHHHcccccccccccccHHHHHHccccccccccccccccccccccccccccccc
***FPAQPDLSLQI***********************************************************************************************************FHSFHH************************************LGFLRPIRGIPVYQNP**********************************************************************MRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTV***********************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELFPAQPDLSLQISPPNSKPSSTWSSRRGAAAEEEMDLGFWKRALDSRNSSSMAAANAKPSSDISTGGGFELSLSNPARVSSSSVLSESLSSNNNLNHHHQFHLLQNNTTTTTNCNGNNIFHSFHHQQNHSQFPTHHHLHQNQHHHPVLYHQPPQQQGLSQELGFLRPIRGIPVYQNPHHHHHHHQASHAFPFPHHQQQPLDSPPPPSLVANNNTSTSSLNSFQSQQGLMRSRFMSRFPAKRSMRAPRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRTVKTTDRAAASSGQSDAFENGSSGDTSEDIMFGIQHPRRPETSSIQQQGRASNGLWSNSSSREAWLHGKTKDSAINLPSLEEVDPKCMSYEGISDGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable transcription factor KAN2 Probable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument.probableQ9C616

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IRZ, chain A
Confidence level:very confident
Coverage over the Query: 244-304
View the alignment between query and template
View the model in PyMOL