Citrus Sinensis ID: 016016


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MLIRYGVSTGFASLGSVKNCMLASSAVFRRQQFLIRSLGGYSDHIEPRRMQDIRSMSGTTFEADAENVMREITPVLDPSKHKGQAGKIAVIGGCREYTGAPYFAAISALKIGADLSHVFCTKDAAPVIKSYSPELIVHPILEESYNISGLEDEERRCISSKILAEVDKWMERFDCLVVGPGLGRDPYLLECVSEIMKHARQSNVPIVIDGDGLFLVTNSIDLVSGYPLAVLTPNVNEYKRLVQKVLNCEVNDRDAPELLQSLAKQIGGVTILQKGKSDLISDGEIAKSVSIYGSPRRCGGQGDILSGSVAVFLSWARAKGKATTRLYYNLSFKLGRQLFCFLSLISCLATYSFLMRLLQSDESNGVGLHCWICSIEKGGISCFQRQEKVNSDHRHH
cccccccccCEEECccccccccccccccccEEEEEEEcccccccccccHHHHcccccccccHHcHHHHHHHccccccccccccccccEEEEEcccccccHHHHHHHHHHHccccCEEEEcccccHHHHHHccccEEEEccccccccccccccHHHHHHcHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEccHHHHHHccccccccccccEEcccHHHHHHHHccccccHcccccHHHHHHHHHHHHccEEEEEcccccEEEcccEEEEEccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHHcccccccccccHHHcccccccccc
**IRYGVSTGFASLGSVKNCMLASSAVFRRQQFLIRSLGGYSDHIEPRRMQDIRSMSGTTFEADAENVMREITPVLDPSKHKGQAGKIAVIGGCREYTGAPYFAAISALKIGADLSHVFCTKDAAPVIKSYSPELIVHPILEESYNISGLEDEERRCISSKILAEVDKWMERFDCLVVGPGLGRDPYLLECVSEIMKHARQSNVPIVIDGDGLFLVTNSIDLVSGYPLAVLTPNVNEYKRLVQKVLNCEVNDRDAPELLQSLAKQIGGVTILQKGKSDLISDGEIAKSVSIYGSPRRCGGQGDILSGSVAVFLSWARAKGKATTRLYYNLSFKLGRQLFCFLSLISCLATYSFLMRLLQSDESNGVGLHCWICSIEKGGISCFQ************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIRYGVSTGFASLGSVKNCMLASSAVFRRQQFLIRSLGGYSDHIEPRRMQDIRSMSGTTFEADAENVMREITPVLDPSKHKGQAGKIAVIGGCREYTGAPYFAAISALKIGADLSHVFCTKDAAPVIKSYSPELIVHPILEESYNISGLEDEERRCISSKILAEVDKWMERFDCLVVGPGLGRDPYLLECVSEIMKHARQSNVPIVIDGDGLFLVTNSIDLVSGYPLAVLTPNVNEYKRLVQKVLNCEVNDRDAPELLQSLAKQIGGVTILQKGKSDLISDGEIAKSVSIYGSPRRCGGQGDILSGSVAVFLSWARAKGKATTRLYYNLSFKLGRQLFCFLSLISCLATYSFLMRLLQSDESNGVGLHCWICSIEKGGISCFQRQEKVNSDHRHH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent (S)-NAD(P)H-hydrate dehydratase Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S-and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.probableF6HDM2
ATP-dependent (S)-NAD(P)H-hydrate dehydratase Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S-and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.probableQ94AF2
ATP-dependent (S)-NAD(P)H-hydrate dehydratase Catalyzes the dehydration of the S-form of NAD(P)HX at the expense of ATP, which is converted to ADP. Together with NAD(P)HX epimerase, which catalyzes the epimerization of the S-and R-forms, the enzyme allows the repair of both epimers of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration.probableE1BNQ4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R3B, chain A
Confidence level:very confident
Coverage over the Query: 62-142,163-331
View the alignment between query and template
View the model in PyMOL
Template: 3RSS, chain A
Confidence level:very confident
Coverage over the Query: 17-48,59-143,155-331
View the alignment between query and template
View the model in PyMOL
Template: 3NL6, chain A
Confidence level:confident
Coverage over the Query: 100-139,163-351
View the alignment between query and template
View the model in PyMOL