BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016031
(396 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4E2Q|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2Q|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana
pdb|4E2S|A Chain A, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|B Chain B, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|C Chain C, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|D Chain D, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|E Chain E, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|F Chain F, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|G Chain G, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|H Chain H, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|I Chain I, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|J Chain J, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|K Chain K, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|L Chain L, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|M Chain M, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|N Chain N, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|O Chain O, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
pdb|4E2S|P Chain P, Crystal Structure Of (S)-Ureidoglycine Aminohydrolase From
Arabidopsis Thaliana In Complex With Its Substrate,
(S)-Ureidoglycine
Length = 266
Score = 28.5 bits (62), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 18/65 (27%), Positives = 27/65 (41%), Gaps = 8/65 (12%)
Query: 197 SIAKQDFDPEQVLKTKVTHVHQHAFIKEHFLG--------YGKDSALLGWMLSFFKQFYA 248
+I DF P + L K H +QH + G Y + + WM F Q+YA
Sbjct: 187 NIHTMDFQPGEFLNVKEVHYNQHGLLLLEGQGIYRLGDNWYPVQAGDVIWMAPFVPQWYA 246
Query: 249 SITKA 253
++ K
Sbjct: 247 ALGKT 251
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.142 0.451
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,444,776
Number of Sequences: 62578
Number of extensions: 375573
Number of successful extensions: 911
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 910
Number of HSP's gapped (non-prelim): 1
length of query: 396
length of database: 14,973,337
effective HSP length: 101
effective length of query: 295
effective length of database: 8,652,959
effective search space: 2552622905
effective search space used: 2552622905
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 52 (24.6 bits)