Citrus Sinensis ID: 016093

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----

MYLSEKPRPYLTEKPRPIDYYKDEAVAAAAAAAAAASSRDMIMEVAAASNGELQPQQMILADSSGGEDHEVRAPKKRAETWVQDETRILIAFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFKKTKHQDRGSGSAKMSYYKEIDEILKERSKNAQYKATSVANSANKVDTFMQFSDKGFDDTSISFGPVEATGRPTLNLERRLDHDGHPLAITTADAVAAAGVPPWNWRDPPPGNGGEGQSFGGKVISVKCGDYTRRIGIDGTPDAIKEAIKSAFGIRTKRAFWLEDEDQIVRCIDRDMPVGNYTLHLDEGLTIKVCLYDESDHISVHTEDKTFYTEEDYREFLARHGWTCLREFDGYRNVDNMDDLRPGAMYRGVT

cccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccEEEEECccccEEECccccHHHHHHHHHHHHccHHHHHHcccccHHHHHHcccccccccEEEEcccccEEEEEEccccccccccccccccccHHHHHHHHHHHcccccEEccccccccccccccccccccccc

*******************************************************************************TWVQDETRILIAFRREMDGLFNTSKSNKHLWEQISAKMREKGFDRSPTMCTDKWRNLLKEFK***************YYKEIDEIL******************************************************RLDHDGHPLAITTADAVAAAGVPPWNWR************FGGKVISVKCGDYTRRIGIDGTPDAIKEAIKSAFGIRTKRAFWLEDEDQIVRCIDRDMPVGNYTLHLDEGLTIKVCLYDESDHISVHTEDKTFYTEEDYREFLARHGWTCLREFDGYRNVDNMDDLRPGAMYRG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Trihelix transcription factor GT-1	Probable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals.	probable	Q9FX53

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EBI, chain A
Confidence level:very confident
Coverage over the Query: 75-160
View the alignment between query and template
View the model in PyMOL