BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016099
         (395 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q91XJ0|CREST_RAT Calcium-responsive transcription coactivator OS=Rattus norvegicus
           GN=Ss18l1 PE=1 SV=1
          Length = 401

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 4/48 (8%)

Query: 195 LSDSCIPLHNFDYVYNYLMYTNVSYVDCFEDPGPH----GNGRYSEHM 238
           +S    P  + DY Y    YT  SY   FEDP  H    GN +YS+  
Sbjct: 272 MSQQYYPDGHSDYAYQQSSYTEQSYDRSFEDPTQHYYEGGNSQYSQQQ 319


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.324    0.138    0.448 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 159,767,038
Number of Sequences: 539616
Number of extensions: 6935091
Number of successful extensions: 16313
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 16313
Number of HSP's gapped (non-prelim): 2
length of query: 395
length of database: 191,569,459
effective HSP length: 120
effective length of query: 275
effective length of database: 126,815,539
effective search space: 34874273225
effective search space used: 34874273225
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)