Citrus Sinensis ID: 016100


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MMLKLLVLFLFFQISVSEIFFEERFDDGWRSRWVISDWKRSEGKAGYFKHTAGKWHGDPDDKGIQTHTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEEVLSNREEAQRAREEGEKRRRERGYDRRRYRDRYRDKYRRHDYLDDDYHDEL
cHHHHHHHHHHHccccEEEEEEccccccccccEEEcccccccccccEEEEEccccccccccccCEEcccccccEEccccccccccccEEEEEEEEEccccccccccEEEEEccccccccccccccEEEEEccccccccccEEEEEEccccccccccccccccccccccEEEEEEccccCEEEEEccCEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccccccccccc
*MLKLLVLFLFFQISVSEIFFEERFDDGWRSRWVISDWKRSEGKAGYFKHTAGKWHGDPDDKGIQTHTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVN*K***DWDDREYIDDPNAVKPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYAKQVVEEVLSN***********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLKLLVLFLFFQISVSEIFFEERFDDGWRSRWVISDWKRSEGKAGYFKHTAGKWHGDPDDKGIQTHTDARHYAISAKIPEFSNKNRTLVVQYSIRFEQDIECGGGYIKLLSAYVNQKKFGGDAPYSLMFGPDICGTQKKHLHVILSYQGQNYPIKKELECETDKLTHFYTFILRPDASYSILIDNRERDSGSMYTDWDILPPRKIKAVNAKKPADWDDREYIDDPNAVKPEGYDSIPKEIPDPKAKKPDNWDEDEDGLWKPPKIPNPAYKGPWRPKRIKNPNYKGKWKIPYIDNPEFEDDPDLYVLKPIKYVGIEVWQVKAGSVYDNILICDDPAYxxxxxxxxxxxxxxxxxxxxxxxxxRRERGYDRRRYRDRYRDKYRRHDYLDDDYHDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calreticulin-3 Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER.confidentO04153
Calreticulin Molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin/calnexin cycle. This lectin may interact transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER.probableP27798
Calreticulin Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis.probableP14211

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RG0, chain A
Confidence level:very confident
Coverage over the Query: 16-203,221-235,267-269,281-363
View the alignment between query and template
View the model in PyMOL
Template: 1HHN, chain A
Confidence level:very confident
Coverage over the Query: 203-303
View the alignment between query and template
View the model in PyMOL