Citrus Sinensis ID: 016113


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MGEVSREELPLPSLFERGRKIHQIATESGCDPDAVRKGCEVLEKCEDMVGKLGLFSSNETKDDISTANLKYILVPYFLGELIEKIAQDDRLQILKASQAKLKEFISFCEIMELVPEEELEAVAQAKPTAFTDQRARKIARFKRQRAAESKLQEIKERKERRGRSTRAAAPSAPVEAGEEDVLDDDGEEEREAWLTTISLAVCKKEEDMLSAVKERQLKGGEEEFSEVVLDERSKKAESWHRDAAIRAQYTKPAQPITCATFAQDVLEGRAKVSQAHEHKHQPMIFGPASLVGGGLTSERERMAAQVFQPMHRLPTMSIEEAGLKEMEMMNKWQEMNVKLMEEANSAWYKDNRKLGTSENDNEDDDDDAVQKARAFDDWKDDNPRGAGNKKLTPCG
ccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccccccccccc
************SLFERGR***QIAT**GCDPDAVRKGCEVLEKCEDMVGKLGLFSSNETKDDISTANLKYILVPYFLGELIEKIAQDDRLQILKASQAKLKEFISFCEIMELVPEE********************************************************************GEEEREAWLTTISLAVCKKEEDMLSAVK*******************************************TC*TF***********************FG*ASLV**GLTSERERMAAQVFQPMHRLPTMSIEEAGLK********************************************VQKARAFDDWKDDNPRGA*N*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEVSREELPLPSLFERGRKIHQIATESGCDPDAVRKGCEVLEKCEDMVGKLGLFSSNETKDDISTANLKYILVPYFLGELIEKIAQDDRLQILKASQAKLKEFISFCEIMELVPEEELEAVAQAKPTAFTDQRARKIARFKRQRAAESKLQEIKERKERRGRSTRAAAPSAPVEAGEEDVLDDDGEEEREAWLTTISLAVCKKEEDMLSAVKERQLKGGEEEFSEVVLDERSKKAESWHRDAAIRAQYTKPAQPITCATFAQDVLEGRAKVSQAHEHKHQPMIFGPASLVGGGLTSERERMAAQVFQPMHRLPTMSIEEAGLKEMEMMNKWQEMNVKLMEEANSAWYKDNRKLGTSENDNEDDDDDAVQKARAFDDWKDDNPRGAGNKKLTPCG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PP2A regulatory subunit TAP46 Seems to act as a regulator of PP2A catalytic activity.probableQ8LDQ4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V0P, chain A
Confidence level:very confident
Coverage over the Query: 9-156,186-211
View the alignment between query and template
View the model in PyMOL