Citrus Sinensis ID: 016164


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPIFTGDGEGGSGFAAAAAAAAASGASGYEFGVDPNLDPELALALRVSMEEERARQEAAAKRAAEEAAKKEKQGEQQSSSQDVTMTDQDSVPASEADDKKKTTKHDEGLLQEAIAMSSTPSYPSGRDTNMSEVAEDDPELALALQLSMQDGTKDAPSHSDMSQLLADQAFVSSILASLPGVDPEDPSVKDVLTSMQNQSEVSSSDLVG
cccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEEcccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccEEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEECcccccccHHHHHHHHHHHccccccEEEECccccccHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHHcccHHHHHHHHccccccccccHHHHHHHHHHHHccccccccccc
*VLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALK*****KQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPIFTGDGE**SGF*************GYEFGVDPNLDPELALALRV***********************************************************************************************************************DQAFVSSILASLPGVDPEDP**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLEATLICIDNSEWMRNGDYAPSRFQAQTEAANLICGAKTQLNPENTVGVMTMAGKGVRVLVTPTSDLGKILACMHGLEIGGELNLAAGIQVAQLALKHRQNKKQQQRIIVFVGSPIKHEKKVLEMIGRKLKKNSVALDIVNFGEDDEGNTEKLEALLAAVNNNDSSHLVHVPPGPNALSDVLLSTPIFTGDGEGGSGFAAAAAAAAASGASGYEFGVDPNLDPELALALxxxxxxxxxxxxxxxxxxxxxxxxxxxxGEQQSSSQDVTMTDQDSVPASEADDKKKTTKHDEGLLQEAIAMSSTPSYPSGRDTNMSEVAEDDPELALALQLSMQDGTKDAPSHSDMSQLLADQAFVSSILASLPGVDPEDPSVKDVLTSMQNQSEVSSSDLVG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
26S proteasome non-ATPase regulatory subunit 4 Binds and presumably selects ubiquitin-conjugates for destruction. Prefers multiubiquitin chains rather than single ubiquitins. Plays a role in the growth and development via the proteasome-dependent degradation of the ABA-signaling protein ABI5/DPBF1.probableP55034
26S proteasome non-ATPase regulatory subunit 4 Binds and presumably selects ubiquitin-conjugates for destruction.probableP55035
26S proteasome non-ATPase regulatory subunit 4 Binds and presumably selects ubiquitin-conjugates for destruction. Displays selectivity for longer polyubiquitin chains. Modulates intestinal fluid secretion.probableP55036

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2X5N, chain A
Confidence level:very confident
Coverage over the Query: 2-192
View the alignment between query and template
View the model in PyMOL
Template: 4B4T, chain W
Confidence level:very confident
Coverage over the Query: 1-193
View the alignment between query and template
View the model in PyMOL
Template: 1YX4, chain A
Confidence level:very confident
Coverage over the Query: 208-338
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 229-298
View the alignment between query and template
View the model in PyMOL