Citrus Sinensis ID: 016186

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390----
MEPLSEREEEQLERFDLVADTDLASASSGLSFVLSTDDSRSTTSSGDISASSGEIPAILVEETVVPRLVDPIPSIGELTVAVTPTARLMCVGRDNKGVTWGLTSVIGRRREMEDAVTVMPGFMSRTCDHVGGCTAPGSRSCGEISPIHFFGVYDGHGGSQVAKFCAERMHEVIAEEWDRERVCSDWQRRWEVAFSSGFERTDNEVLTEAAAPEMVGSTAVVVVLSGCQIITSNCGDSRAVLCRGTETIPLTVDQKPDRQDELERIEGAGGRVINWNGARVFGVLAMSRAIGDRYLRPCIIPVPEITFTTRTDEDECLILASDGLWDVMTNEEVGEVARRLLRRRRRSLLVDEVSPAQVVADNLTEIAYGRNSSDNISIIVVDLKAKKKRQQRQQ
cccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECcccccccccEEEEEcEEcccccccccEEEcccccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEEcccccEEEEcccCEcccccccccccHHHHHHHHHcccEEEEccccccccHHHHHHHcccccccccccccccEEEEEccccccEEEEEcccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHcc
*********************************************************************************************DNKGVTWGLTSVIGRRREMEDAVTVMPGFMSRTCDHVGGCTAPGSRSCGEISPIHFFGVYDGHGGSQVAKFCAERMHEVIAEEWDRERVCSDWQRRWEVAFSSGFERTDNEVLTEAAAPEMVGSTAVVVVLSGCQIITSNCGDSRAVLCRGTETIPLTVDQKPDRQDELERIEGAGGRVINWNGARVFGVLAMSRAIGDRYLRPCIIPVPEITFTTRTDEDECLILASDGLWDVMTNEEVGEVARRLLRRRRRSLL*DEVSPAQVVADNLTEIAYGRNSSDNISIIVVDL***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPLSEREEEQLERFDLVADTDLASASSGLSFVLSTDDSRSTTSSGDISASSGEIPAILVEETVVPRLVDPIPSIGELTVAVTPTARLMCVGRDNKGVTWGLTSVIGRRREMEDAVTVMPGFMSRTCDHVGGCTAPGSRSCGEISPIHFFGVYDGHGGSQVAKFCAERMHEVIAEEWDRERVCSDWQRRWEVAFSSGFERTDNEVLTEAAAPEMVGSTAVVVVLSGCQIITSNCGDSRAVLCRGTETIPLTVDQKPDRQDELERIEGAGGRVINWNGARVFGVLAMSRAIGDRYLRPCIIPVPEITFTTRTDEDECLILASDGLWDVMTNEEVGEVARRLLRRRRRSLLVDEVSPAQVVADNLTEIAYGRNSSDNISIIVVDLKAKKKRQQRQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable protein phosphatase 2C 6 probableQ0JLP9
Protein phosphatase 2C 56 Key component and repressor of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomatal closure, osmotic water permeability of the plasma membrane (Pos), drought-induced resistance and rhizogenesis, response to glucose, high light stress, seed germination and inhibition of vegetative growth. During the stomatal closure regulation, modulates the inward calcium-channel permeability as well as the actin reorganization in guard cells in response to ABA. Involved in the resistance to the bacterial pathogen Pseudomonas syringae pv. tomato. Controls negatively fibrillin expression that is involved in mediating ABA-induced photoprotection. May be involved in ABA content regulation. Plays a role in the Pro accumulation in response to reduced water availability (low water potential). Required for the ABA negative regulation of the ethylene-induced hyponastic growth. Involved in acquired thermotolerance of root growth and seedling survival. Activates/represses SRK2E/OST1 in response to ABA-dependent stimuli, especially in stomata closure regulation involving SLAC1.probableP49597

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QN1, chain B
Confidence level:very confident
Coverage over the Query: 96-131,143-387
View the alignment between query and template
View the model in PyMOL