BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016227
(393 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2PMS|C Chain C, Crystal Structure Of The Complex Of Human Lactoferrin
N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal
Surface Protein A
pdb|2PMS|D Chain D, Crystal Structure Of The Complex Of Human Lactoferrin
N-Lobe And Lactoferrin-Binding Domain Of Pneumococcal
Surface Protein A
Length = 125
Score = 28.5 bits (62), Expect = 6.0, Method: Compositional matrix adjust.
Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 2/61 (3%)
Query: 280 IKRKFSIQKALLSKADRSS--IDRLRQQIYNLEKQQRRLEEDVYVYNWLQDQLRLSPACK 337
++ K +KA LSK + S ID L +I LE Q + EE+ V ++ ++ L + A K
Sbjct: 49 LQSKLDAKKAKLSKLEELSDKIDELDAEIAKLEDQLKAAEENNNVEDYFKEGLEKTIAAK 108
Query: 338 K 338
K
Sbjct: 109 K 109
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.127 0.364
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,291,171
Number of Sequences: 62578
Number of extensions: 278601
Number of successful extensions: 672
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 669
Number of HSP's gapped (non-prelim): 7
length of query: 393
length of database: 14,973,337
effective HSP length: 101
effective length of query: 292
effective length of database: 8,652,959
effective search space: 2526664028
effective search space used: 2526664028
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 52 (24.6 bits)