Citrus Sinensis ID: 016242

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390--
MAATAACSLQMAAVKPCISSSHRGVKAGVAVVGGNSKGASWTKLSSASHISSGQPFLRSFTSSSVKFDKVVTRAMAESSTNKPISGLPIDLKGKRAFIAGVADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKIYPLDAIYDKLEDVPEDVKSNKRYSGSSKWTVQECAESVKQDFGSIDILVHSLANGPEVSKPLLETSRNGYLAALSASSYSYVSLLKHFIPLMNPGGSSLSLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHRIRVNAISAGPLRSRAAKAIGFIDTMIEYSLANAPLQKELSADEVGNTAAFLASPLASAITGAVIYVDNGLNAMGVGVDSPIFKDLDIPTDKH
cccccccccHHHHcccccccccccccccccEEccccccccHHHHccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccccccccccccccccccEEEEccccccccccccHHHcccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccCCccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccEEEEcccccccccccccccccccccccccc
***********************GVKAGVAVVG********TKL*S***************************************GLPIDLKGKRAFIAGVADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKIYPLDAIYDKLEDVPEDVKSNKRYSGSSKWTVQECAESVKQDFGSIDILVHSLANGPEVSKPLLETSRNGYLAALSASSYSYVSLLKHFIPLMNPGGSSLSLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHRIRVNAISAGPLRSRAAKAIGFIDTMIEYSLANAPLQKELSADEVGNTAAFLASPLASAITGAVIYVDNGLNAMGVGVDSPIFKDL*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAATAACSLQMAAVKPCISSSHRGVKAGVAVVGGNSKGASWTKLSSASHISSGQPFLRSFTSSSVKFDKVVTRAMAESSTNKPISGLPIDLKGKRAFIAGVADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDESRVLPDGSLMEITKIYPLDAIYDKLEDVPEDVKSNKRYSGSSKWTVQECAESVKQDFGSIDILVHSLANGPEVSKPLLETSRNGYLAALSASSYSYVSLLKHFIPLMNPGGSSLSLTYIASERIIPGYGGGMSSAKAALESDTRVLAFEAGRKHRIRVNAISAGPLRSRAAKAIGFIDTMIEYSLANAPLQKELSADEVGNTAAFLASPLASAITGAVIYVDNGLNAMGVGVDSPIFKDLDIPTDKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic Catalyzes the NAD-dependent reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Catalyzes the last reduction step in the de novo synthesis cycle of fatty acids. Involved in the elongation cycle of fatty acids which are used in lipid metabolism. Required for normal plant growth.confidentQ9SLA8
Enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic Catalyzes the NAD-dependent reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Catalyzes the last reduction step in the de novo synthesis cycle of fatty acids. Involved in the elongation cycle of fatty acids which are used in lipid metabolism. Required for normal plant growth.confidentQ6Z0I4
Enoyl-[acyl-carrier-protein] reductase [NADH], chloroplastic probableP80030

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.3.-.-Acting on the CH-CH group of donors.probable
1.3.1.-10-hydroxytaxane O-acetyltransferase.probable
1.3.1.9Enoyl-[acyl-carrier-protein] reductase (NADH).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D7O, chain A
Confidence level:very confident
Coverage over the Query: 87-382
View the alignment between query and template
View the model in PyMOL