BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016256
(392 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1IJL|A Chain A, Crystal Structure Of Acidic Phospholipase A2 From
Deinagkistrodon Acutus
pdb|1IJL|B Chain B, Crystal Structure Of Acidic Phospholipase A2 From
Deinagkistrodon Acutus
Length = 123
Score = 29.3 bits (64), Expect = 3.8, Method: Composition-based stats.
Identities = 19/61 (31%), Positives = 27/61 (44%), Gaps = 3/61 (4%)
Query: 84 FIEENNEKQSGGAIKCGRNRCNCFNGTCNESSEDELDSYYGDSNLASSAEACEILKSLVP 143
+ EEN + GG C R C C + + D LD+Y D+ + CE +S P
Sbjct: 66 YSEENGDIVCGGDDPCKREICEC-DRVAADCFRDNLDTYNSDTYWRYPRQDCE--ESPEP 122
Query: 144 C 144
C
Sbjct: 123 C 123
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.130 0.374
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,603,688
Number of Sequences: 62578
Number of extensions: 394538
Number of successful extensions: 593
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 592
Number of HSP's gapped (non-prelim): 3
length of query: 392
length of database: 14,973,337
effective HSP length: 101
effective length of query: 291
effective length of database: 8,652,959
effective search space: 2518011069
effective search space used: 2518011069
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 52 (24.6 bits)