BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016256
         (392 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q10914|GLR2_CAEEL Glutamate receptor 2 OS=Caenorhabditis elegans GN=glr-2 PE=1 SV=3
          Length = 977

 Score = 36.6 bits (83), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 42  RNSSPAEKVEEPVHVNK---EVSNGGSAAAEFEPSSVCLAKMVQNFIEENNEKQ 92
           R + P E VE+  + NK    V+ GGS AA FE S V L K + NF+    +KQ
Sbjct: 720 RMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQ 773


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.312    0.129    0.368 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 141,265,580
Number of Sequences: 539616
Number of extensions: 5725357
Number of successful extensions: 14182
Number of sequences better than 100.0: 42
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 37
Number of HSP's that attempted gapping in prelim test: 14138
Number of HSP's gapped (non-prelim): 76
length of query: 392
length of database: 191,569,459
effective HSP length: 119
effective length of query: 273
effective length of database: 127,355,155
effective search space: 34767957315
effective search space used: 34767957315
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)