BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016256
(392 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q10914|GLR2_CAEEL Glutamate receptor 2 OS=Caenorhabditis elegans GN=glr-2 PE=1 SV=3
Length = 977
Score = 36.6 bits (83), Expect = 0.32, Method: Compositional matrix adjust.
Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 3/54 (5%)
Query: 42 RNSSPAEKVEEPVHVNK---EVSNGGSAAAEFEPSSVCLAKMVQNFIEENNEKQ 92
R + P E VE+ + NK V+ GGS AA FE S V L K + NF+ +KQ
Sbjct: 720 RMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQ 773
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.312 0.129 0.368
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 141,265,580
Number of Sequences: 539616
Number of extensions: 5725357
Number of successful extensions: 14182
Number of sequences better than 100.0: 42
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 37
Number of HSP's that attempted gapping in prelim test: 14138
Number of HSP's gapped (non-prelim): 76
length of query: 392
length of database: 191,569,459
effective HSP length: 119
effective length of query: 273
effective length of database: 127,355,155
effective search space: 34767957315
effective search space used: 34767957315
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 62 (28.5 bits)