BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016266
         (392 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3C8T|A Chain A, Crystal Structure Of Fumarate Lyase From Mesorhizobium Sp.
           Bnc1
          Length = 451

 Score = 28.5 bits (62), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 275 EIVTPALGV---SGVGGAMAVYG--AFDAICSLAAGRLTTGLPSITFIVSGGAIAQVVVF 329
           E ++P + V   SG  G +A  G    D    LA   L  G+PSIT+  +  A+A+ V F
Sbjct: 179 EEISPRVLVVEFSGASGTLASLGTRGLDVQRELAR-ELNLGVPSITWHSARDAVAETVQF 237

Query: 330 LWILINYSVTSGVLGTL 346
           L      ++ SG LG L
Sbjct: 238 L------ALVSGSLGKL 248


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,706,036
Number of Sequences: 62578
Number of extensions: 418969
Number of successful extensions: 856
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 854
Number of HSP's gapped (non-prelim): 4
length of query: 392
length of database: 14,973,337
effective HSP length: 101
effective length of query: 291
effective length of database: 8,652,959
effective search space: 2518011069
effective search space used: 2518011069
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)