BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016266
(392 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3C8T|A Chain A, Crystal Structure Of Fumarate Lyase From Mesorhizobium Sp.
Bnc1
Length = 451
Score = 28.5 bits (62), Expect = 7.5, Method: Compositional matrix adjust.
Identities = 27/77 (35%), Positives = 38/77 (49%), Gaps = 12/77 (15%)
Query: 275 EIVTPALGV---SGVGGAMAVYG--AFDAICSLAAGRLTTGLPSITFIVSGGAIAQVVVF 329
E ++P + V SG G +A G D LA L G+PSIT+ + A+A+ V F
Sbjct: 179 EEISPRVLVVEFSGASGTLASLGTRGLDVQRELAR-ELNLGVPSITWHSARDAVAETVQF 237
Query: 330 LWILINYSVTSGVLGTL 346
L ++ SG LG L
Sbjct: 238 L------ALVSGSLGKL 248
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.138 0.409
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,706,036
Number of Sequences: 62578
Number of extensions: 418969
Number of successful extensions: 856
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 854
Number of HSP's gapped (non-prelim): 4
length of query: 392
length of database: 14,973,337
effective HSP length: 101
effective length of query: 291
effective length of database: 8,652,959
effective search space: 2518011069
effective search space used: 2518011069
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)