Query         016300
Match_columns 392
No_of_seqs    26 out of 28
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 05:36:46 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/016300.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/016300hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01465 GRIP:  GRIP domain;  I  48.0      19 0.00041   26.6   2.6   25  266-291     9-33  (46)
  2 KOG1996 mRNA splicing factor [  45.6      22 0.00047   36.6   3.4   65   27-92     38-113 (378)
  3 PF09588 YqaJ:  YqaJ-like viral  45.0      14  0.0003   30.8   1.7   18  326-343   135-152 (152)
  4 PF00023 Ank:  Ankyrin repeat H  33.2      38 0.00082   22.0   2.0   21  159-179    12-32  (33)
  5 PF03765 CRAL_TRIO_N:  CRAL/TRI  28.6      65  0.0014   23.3   2.8   24  265-288    30-54  (55)
  6 PF14967 FAM70:  FAM70 protein   27.3      99  0.0021   31.8   4.7   24   60-83    304-327 (327)
  7 PRK13855 type IV secretion sys  22.3   2E+02  0.0043   30.1   5.8   18   13-30     37-54  (376)
  8 PF06870 RNA_pol_I_A49:  A49-li  22.2      43 0.00094   32.9   1.1   32  275-307   329-380 (385)
  9 smart00755 Grip golgin-97, Ran  19.0 1.1E+02  0.0024   23.0   2.4   23  266-290     8-30  (46)
 10 PF06755 DUF1219:  Protein of u  17.9      46 0.00099   29.7   0.3   17  362-378    67-83  (114)

No 1  
>PF01465 GRIP:  GRIP domain;  InterPro: IPR000237 The GRIP (golgin-97, RanBP2alpha,Imh1p and p230/golgin-245) domain [, , ] is found in many large coiled-coil proteins. It has been shown to be sufficient for targeting to the Golgi []. The GRIP domain contains a completely conserved tyrosine residue.; GO: 0005515 protein binding, 0000042 protein targeting to Golgi; PDB: 1R4A_H 1UPT_B.
Probab=47.95  E-value=19  Score=26.61  Aligned_cols=25  Identities=16%  Similarity=0.347  Sum_probs=18.9

Q ss_pred             hhhHHHHhhcCCCHHHHHHHHHhhhc
Q 016300          266 KGVAYSYLSSKLSAEAANSAFRILSA  291 (392)
Q Consensus       266 K~VVl~wLa~KL~~~~An~~~R~LS~  291 (392)
                      ||||++||..+= ++....+++.|+.
T Consensus         9 KNvl~~fl~~~~-~~~~~~llpvi~t   33 (46)
T PF01465_consen    9 KNVLLQFLESRE-PSEREQLLPVIAT   33 (46)
T ss_dssp             HHHHHHHHTTSS----HHHHHHHHHH
T ss_pred             HHHHHHHhcCCc-hhhHHHHHHHHHH
Confidence            899999999985 7788888888764


No 2  
>KOG1996 consensus mRNA splicing factor [RNA processing and modification]
Probab=45.59  E-value=22  Score=36.59  Aligned_cols=65  Identities=25%  Similarity=0.297  Sum_probs=45.0

Q ss_pred             hhhhHhhhhcccCCCCccCccccCCCCCCC-----CCCCcccCCCCCCCCCCCCCCC------CCCCCCCCCCCCCC
Q 016300           27 SFQDVVALHNVLGPSHVSSTSELANPPTTG-----LFEPIEISPAVIPPYPYAGEPL------PPMYPTFPTTYEPN   92 (392)
Q Consensus        27 ~~q~v~~~~~~~~~~~~~~~~~l~~pp~~g-----l~~pieiSPs~~P~~~~P~~a~------sPm~P~f~n~~~P~   92 (392)
                      ..|.-.+++++..|.-+-+.. +-++|++.     +|+||+-.|..-|-++.|.-+.      --.+|-|||.|+-.
T Consensus        38 al~qq~~~r~l~kp~pvi~~~-~k~~~~s~~~qs~~~pp~~aap~~dpi~~g~~a~~~~~~v~~EYdPm~PNdye~v  113 (378)
T KOG1996|consen   38 ALQQQAARRKLVKPPPVIDLS-TKNRTISTAVQSVSFPPIRAAPVSDPISFGPKAATDEEHVKCEYDPMFPNDYEKV  113 (378)
T ss_pred             ccChHHHhccccCCCCceecc-cCCCCCCccccccccCcccccCccCcccccccccccccchhhhcCCCCcchHHHH
Confidence            346677888888888877665 44444443     8999999999999888885531      12356666887643


No 3  
>PF09588 YqaJ:  YqaJ-like viral recombinase domain;  InterPro: IPR019080  This protein is found in many different bacterial species but is of viral origin. The protein forms an oligomer and functions as a processive alkaline exonuclease that digests linear double-stranded DNA in a Mg(2+)-dependent reaction, It has a preference for 5'-phosphorylated DNA ends. It thus forms part of the two-component SynExo viral recombinase functional unit []. ; PDB: 3SZ5_A 3SZ4_A 3SYY_A 3K93_A 1AVQ_A 3SM4_C 3SLP_A.
Probab=44.99  E-value=14  Score=30.83  Aligned_cols=18  Identities=39%  Similarity=0.464  Sum_probs=15.7

Q ss_pred             hHHHHHHhhhHhhhhhhh
Q 016300          326 LNAYIAGVQKQMLITNKQ  343 (392)
Q Consensus       326 l~sYvs~lQkQ~lITNlQ  343 (392)
                      -+.|...+|-||+||++|
T Consensus       135 p~~Y~~QvQ~qm~vtg~e  152 (152)
T PF09588_consen  135 PHYYYAQVQHQMAVTGAE  152 (152)
T ss_dssp             HHHHHHHHHHHHHHHT-S
T ss_pred             CHHHHHHHHHHHHHHCcC
Confidence            689999999999999975


No 4  
>PF00023 Ank:  Ankyrin repeat Hereditary spherocytosis;  InterPro: IPR002110  The ankyrin repeat is one of the most common protein-protein interaction motifs in nature. Ankyrin repeats are tandemly repeated modules of about 33 amino acids. They occur in a large number of functionally diverse proteins mainly from eukaryotes. The few known examples from prokaryotes and viruses may be the result of horizontal gene transfers []. The repeat has been found in proteins of diverse function such as transcriptional initiators, cell-cycle regulators, cytoskeletal, ion transporters and signal transducers. The ankyrin fold appears to be defined by its structure rather than its function since there is no specific sequence or structure which is universally recognised by it.  The conserved fold of the ankyrin repeat unit is known from several crystal and solution structures [, , , ]. Each repeat folds into a helix-loop-helix structure with a beta-hairpin/loop region projecting out from the helices at a 90o angle. The repeats stack together to form an L-shaped structure [, ].; GO: 0005515 protein binding; PDB: 1D9S_A 1NFI_F 1IKN_D 1WDY_A 1OT8_C 1QYM_A 1TR4_A 1UOH_A 1N11_A 1K1A_A ....
Probab=33.15  E-value=38  Score=21.96  Aligned_cols=21  Identities=24%  Similarity=0.362  Sum_probs=17.0

Q ss_pred             hhHHHHHHHHhhcCCcCCcCc
Q 016300          159 DCFSDILSILASRGANHTIPT  179 (392)
Q Consensus       159 ~CfSDi~~iL~s~GAn~~l~~  179 (392)
                      +--.|+.++|.++||+-++.+
T Consensus        12 ~~~~~~v~~Ll~~ga~~~~~d   32 (33)
T PF00023_consen   12 RGHPDIVKLLLKHGADINARD   32 (33)
T ss_dssp             TTCHHHHHHHHHTTSCTTCBC
T ss_pred             HHHHHHHHHHHHCcCCCCCCC
Confidence            346799999999999987653


No 5  
>PF03765 CRAL_TRIO_N:  CRAL/TRIO, N-terminal domain;  InterPro: IPR008273 This entry defines the N-terminal of various retinaldehyde/retinal-binding proteins that may be functional components of the visual cycle. Cellular retinaldehyde-binding protein (CRALBP) carries 11-cis-retinol or 11-cis-retinaldehyde as endogenous ligands and may function as a substrate carrier protein that modulates interaction of these retinoids with visual cycle enzymes []. The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains []. Trio is a multifunctional protein that integrates and amplifies signals involved in coordinating actin remodeling, which is necessary for cell migration and growth. Other members of the family are transfer proteins that include, guanine nucleotide exchange factor that may function as an effector of RAC1, phosphatidylinositol/phosphatidylcholine transfer protein that is required for the transport of secretory proteins from the golgi complex and alpha-tocopherol transfer protein that enhances the transfer of the ligand between separate membranes.; PDB: 1OIZ_A 1R5L_A 1OIP_A 3HX3_A 3HY5_A 1AUA_A 3Q8G_A 3B7Q_B 3B7Z_A 3B7N_A ....
Probab=28.59  E-value=65  Score=23.34  Aligned_cols=24  Identities=17%  Similarity=0.234  Sum_probs=20.2

Q ss_pred             chhhHHHHh-hcCCCHHHHHHHHHh
Q 016300          265 CKGVAYSYL-SSKLSAEAANSAFRI  288 (392)
Q Consensus       265 CK~VVl~wL-a~KL~~~~An~~~R~  288 (392)
                      -.++++||| |+|.+-+.|.+||+.
T Consensus        30 ~d~~llRFLRARkf~v~~A~~mL~~   54 (55)
T PF03765_consen   30 DDNFLLRFLRARKFDVEKAFKMLKK   54 (55)
T ss_dssp             SHHHHHHHHHHTTT-HHHHHHHHHH
T ss_pred             CHHHHHHHHHHccCCHHHHHHHHHh
Confidence            449999999 799999999999974


No 6  
>PF14967 FAM70:  FAM70 protein
Probab=27.32  E-value=99  Score=31.80  Aligned_cols=24  Identities=42%  Similarity=0.759  Sum_probs=17.7

Q ss_pred             CcccCCCCCCCCCCCCCCCCCCCC
Q 016300           60 PIEISPAVIPPYPYAGEPLPPMYP   83 (392)
Q Consensus        60 pieiSPs~~P~~~~P~~a~sPm~P   83 (392)
                      |....|--.|.+|.|+|-|||-.|
T Consensus       304 p~~aPp~y~P~yf~PgEKPPPYaP  327 (327)
T PF14967_consen  304 PPNAPPRYAPPYFPPGEKPPPYAP  327 (327)
T ss_pred             CCCCCCCCCCCCCCCCCCCcCCCC
Confidence            555566667888889999888655


No 7  
>PRK13855 type IV secretion system protein VirB10; Provisional
Probab=22.31  E-value=2e+02  Score=30.15  Aligned_cols=18  Identities=22%  Similarity=0.329  Sum_probs=13.7

Q ss_pred             hhhHHHHHHHHHhhhhhh
Q 016300           13 SMCHAFLLFIAWLFSFQD   30 (392)
Q Consensus        13 ~~~~~~~lf~iwl~~~q~   30 (392)
                      ..+-.|.+|+||+.+-|.
T Consensus        37 ~~~~~~~~~~~w~~~~~~   54 (376)
T PRK13855         37 GLVLALSLSLIWLGGRSK   54 (376)
T ss_pred             HHHHHHHHHHHHhccCCC
Confidence            345678999999987654


No 8  
>PF06870 RNA_pol_I_A49:  A49-like RNA polymerase I associated factor ;  InterPro: IPR009668  Saccharomyces cerevisiae A49 is a specific subunit associated with RNA polymerase I (Pol I) in eukaryotes. Pol I maintains transcription activities in A49 deletion mutants. However, such mutants are deficient in transcription activity at low temperatures. Deletion analysis of the fusion yeast homologue indicates that only the C-terminal two thirds are required for function. Transcript analysis has demonstrated that A49 is maximising transcription of ribosomal DNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent, 0005634 nucleus; PDB: 3NFG_A 3NFH_B.
Probab=22.19  E-value=43  Score=32.92  Aligned_cols=32  Identities=44%  Similarity=0.687  Sum_probs=16.3

Q ss_pred             cCCCHHHHHHHHHhhhcCcCCc--------------------cccccCCCchH
Q 016300          275 SKLSAEAANSAFRILSACKVNK--------------------VCPLDFKQPSE  307 (392)
Q Consensus       275 ~KL~~~~An~~~R~LS~CkVNk--------------------vCPL~F~d~s~  307 (392)
                      -|+++....+.||.| ||+|.+                    .=||.||.++.
T Consensus       329 Lkl~~~~l~~~~r~L-GC~v~~~~~~~~~~~~~~~~~~~a~L~~PL~fP~~~~  380 (385)
T PF06870_consen  329 LKLSPKKLTQYFREL-GCKVKKATEALGLSKSEAKTHKIATLKLPLKFPKPRR  380 (385)
T ss_dssp             HT--HHHHHHHHHHT-T-EEEE--HHHT--GGGGGGSEEEE------------
T ss_pred             hCCCHHHHHHHHHHh-CCEecccccccccccccccceeEEEEeCCCCCCCccc
Confidence            489999999999999 799988                    35889988764


No 9  
>smart00755 Grip golgin-97, RanBP2alpha,Imh1p and p230/golgin-245.
Probab=18.95  E-value=1.1e+02  Score=22.99  Aligned_cols=23  Identities=22%  Similarity=0.436  Sum_probs=17.4

Q ss_pred             hhhHHHHhhcCCCHHHHHHHHHhhh
Q 016300          266 KGVAYSYLSSKLSAEAANSAFRILS  290 (392)
Q Consensus       266 K~VVl~wLa~KL~~~~An~~~R~LS  290 (392)
                      |||++.||..|=..  ....++.|+
T Consensus         8 KNVll~fl~~~e~~--r~~ll~vi~   30 (46)
T smart00755        8 KNVLLQFLTLRESE--RETLLKVIS   30 (46)
T ss_pred             HHHHHHHhccCcch--HHHHHHHHH
Confidence            89999999998754  556666554


No 10 
>PF06755 DUF1219:  Protein of unknown function (DUF1219);  InterPro: IPR009610 This family consists of several hypothetical proteins which seem to be specific to the enterobacteria Escherichia coli and Shigella flexneri. Family members are often known as YeeV proteins and are around 125 residues in length. The function of this family is unknown.
Probab=17.91  E-value=46  Score=29.74  Aligned_cols=17  Identities=41%  Similarity=0.599  Sum_probs=15.6

Q ss_pred             cccccccccccccceec
Q 016300          362 TNIYELCDVDLKDFSIQ  378 (392)
Q Consensus       362 ~nIY~LC~I~LKDFSLQ  378 (392)
                      -+.|+|.+||=++||.|
T Consensus        67 VeKY~LvRiD~~gFs~~   83 (114)
T PF06755_consen   67 VEKYELVRIDRNGFSWQ   83 (114)
T ss_pred             HHHHhhhhcCCcccCcc
Confidence            46799999999999998


Done!