BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016329
(391 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2YJ4|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx-
Atpase Copb-B Upon Nucleotide Binding
pdb|2YJ4|B Chain B, Conformational Changes In The Catalytic Domain Of The Cpx-
Atpase Copb-B Upon Nucleotide Binding
pdb|2YJ5|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx-
Atpase Copb-B Upon Nucleotide Binding
pdb|2YJ5|B Chain B, Conformational Changes In The Catalytic Domain Of The Cpx-
Atpase Copb-B Upon Nucleotide Binding
pdb|2YJ6|A Chain A, Conformational Changes In The Catalytic Domain Of The
Cpx-Atpase Copb-B Upon Nucleotide Binding
pdb|2YJ6|B Chain B, Conformational Changes In The Catalytic Domain Of The
Cpx-Atpase Copb-B Upon Nucleotide Binding
Length = 263
Score = 29.3 bits (64), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 5/73 (6%)
Query: 314 GVAINGNISSH--EFK--ENQDTISVFRTGDNEVSAN-SEVDGRNEQQSQENLGKEGLEV 368
G+ + G IS E K EN + I+V+ G+ S N S+V N + E L EGL++
Sbjct: 96 GIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKI 155
Query: 369 HARSATTDDKLSE 381
S +DK+ E
Sbjct: 156 IILSGDKEDKVKE 168
>pdb|2IYE|A Chain A, Structure Of Catalytic Cpx-atpase Domain Copb-b
pdb|2IYE|C Chain C, Structure Of Catalytic Cpx-atpase Domain Copb-b
Length = 263
Score = 29.3 bits (64), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 5/73 (6%)
Query: 314 GVAINGNISSH--EFK--ENQDTISVFRTGDNEVSAN-SEVDGRNEQQSQENLGKEGLEV 368
G+ + G IS E K EN + I+V+ G+ S N S+V N + E L EGL++
Sbjct: 96 GIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKI 155
Query: 369 HARSATTDDKLSE 381
S +DK+ E
Sbjct: 156 IILSGDKEDKVKE 168
>pdb|2YJ3|A Chain A, Conformational Changes In The Catalytic Domain Of The Cpx-
Atpase Copb-B Upon Nucleotide Binding
Length = 263
Score = 29.3 bits (64), Expect = 4.1, Method: Compositional matrix adjust.
Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 5/73 (6%)
Query: 314 GVAINGNISSH--EFK--ENQDTISVFRTGDNEVSAN-SEVDGRNEQQSQENLGKEGLEV 368
G+ + G IS E K EN + I+V+ G+ S N S+V N + E L EGL++
Sbjct: 96 GIGVRGKISDKIIEVKKAENNNDIAVYINGEPIASFNISDVPRPNLKDYLEKLKNEGLKI 155
Query: 369 HARSATTDDKLSE 381
S +DK+ E
Sbjct: 156 IILSGDKEDKVKE 168
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.131 0.375
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,787,029
Number of Sequences: 62578
Number of extensions: 425949
Number of successful extensions: 799
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 795
Number of HSP's gapped (non-prelim): 10
length of query: 391
length of database: 14,973,337
effective HSP length: 101
effective length of query: 290
effective length of database: 8,652,959
effective search space: 2509358110
effective search space used: 2509358110
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 52 (24.6 bits)