Query         016337
Match_columns 391
No_of_seqs    168 out of 889
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 05:56:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/016337.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/016337hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 8.3E-42 1.8E-46  294.1   7.7  127   28-161     1-129 (129)
  2 MTH00213 ND6 NADH dehydrogenas  19.4      76  0.0017   31.2   2.1   57  261-324   123-183 (239)
  3 KOG4286 Dystrophin-like protei  17.9      36 0.00078   38.8  -0.5   87  125-216   613-719 (966)
  4 PHA00692 hypothetical protein   15.5      58  0.0012   26.0   0.3   10   26-35     35-44  (74)
  5 smart00265 BH4 BH4 Bcl-2 homol  13.1   2E+02  0.0044   19.4   2.3   19   37-55      4-22  (27)
  6 PF07960 CBP4:  CBP4;  InterPro  11.6 1.2E+02  0.0026   27.5   1.1   11   35-45     30-40  (128)
  7 PF08260 Kinin:  Insect kinin p  11.0 1.1E+02  0.0024   15.4   0.4    6  271-276     3-8   (8)
  8 cd00265 MADS_MEF2_like MEF2 (m  10.8 1.8E+02  0.0038   23.5   1.8   22  352-373    49-70  (77)
  9 PRK11560 phosphoethanolamine t  10.4 1.6E+02  0.0034   32.3   1.8   30  304-336   525-554 (558)
 10 PF01473 CW_binding_1:  Putativ   9.9 1.9E+02  0.0042   17.1   1.3    8   84-91      7-14  (19)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=8.3e-42  Score=294.07  Aligned_cols=127  Identities=38%  Similarity=0.663  Sum_probs=94.3

Q ss_pred             CCCcceecCChHHHHHHHHHHhhcCCCCCCCCCceeeccCCCCCccccccccccCCCceEEEEecccccccCCCcceecc
Q 016337           28 KVDGIKFKPTAEVLIFVYLAGMVSGSTDGPIFPLIQEVDVYQYEPSKLKSKAHDFGDGNMYFFSRVQKKYKKGSIRERKA  107 (391)
Q Consensus        28 LPPGfRF~PTDEELV~~YL~rKv~G~pl~~~~~~I~evDVY~~ePWdLP~~~~~~gd~eWYFFs~r~rKy~nG~R~nRat  107 (391)
                      |||||||+|||||||.+||++|+.|.+++ ...+|+++|||++|||+|++.... ++++||||+++++++.++.|.+|++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~-~~~~i~~~Diy~~~P~~L~~~~~~-~~~~~yFF~~~~~~~~~~~r~~R~~   78 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLP-CEDVIHDVDIYSAHPWELPAKFKG-GDEEWYFFSPRKKKYPNGGRPNRVT   78 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHC-S-CHSEE--GGGS-GGGCHHHSSS--SSEEEEEEE----------S-EEE
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCC-cccceeecccCccChHHhhhhccC-CCceEEEEEecccccCCcccccccc
Confidence            89999999999999999999999999972 337899999999999999953333 6679999999999999999999999


Q ss_pred             CCceEe-cCCceeeec-CCCeEEEEEEeeeecccCCCCCCCCCcccCeEEEEEEeC
Q 016337          108 KGGFWK-TGKCNTVRG-KDGGTGTERSLTYYSYRHDPKPGEKPIKTHWLMREYMLK  161 (391)
Q Consensus       108 ggGyWK-tG~~K~I~~-~G~vIG~KKtLvFY~gr~~pk~G~~~~KTgWvMhEYrL~  161 (391)
                      ++|+|| +|+++.|.+ +|.+||+|++|+||.++. + ++   .+|+|+||||+|.
T Consensus        79 ~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~-~-~~---~kt~W~M~EY~L~  129 (129)
T PF02365_consen   79 GGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKS-P-NG---KKTGWVMHEYSLE  129 (129)
T ss_dssp             TTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESST-T-S----EEEEEEEEEEEE-
T ss_pred             cceEEeecccccccccccceeeeeEEEEEEEeccC-C-CC---CcCCeEEEEEEeC
Confidence            999999 999999999 999999999999998766 4 67   8999999999984


No 2  
>MTH00213 ND6 NADH dehydrogenase subunit 6; Provisional
Probab=19.43  E-value=76  Score=31.21  Aligned_cols=57  Identities=26%  Similarity=0.182  Sum_probs=34.0

Q ss_pred             CCCCCCCccccccccccccCCCCCCCc----cccCCCCCCCCCCCCCCChhhhhhhhhcCCCCCCccc
Q 016337          261 PNSFQNTTDITFASWGSISPAPNNNFP----LYSSNLNPAASTPERPSSNSFQNMINMMGVSSAAPAD  324 (391)
Q Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  324 (391)
                      |+||-|..   -.-=|..|-+|..++-    -|+|-|.+.-    ...++-|||.|+|++-.+++|+-
T Consensus       123 p~sf~n~~---~~~~g~~~~~~~~~~~~~~~~v~~~~~~~~----~~~~~~~qn~~~~~~~~~~~~~~  183 (239)
T MTH00213        123 PDSFLNNP---SGRGGAERYELTNILSDRNRGVSSLLGSDK----ESITTGIQNNIYMRVGATGAPYL  183 (239)
T ss_pred             CHHHhcCC---CCCCCccccCcchhccccCCChhhhcccch----hcccHHhhhhhcccccccCCccc
Confidence            46676664   3334455555554442    3445444322    23567899999999888888764


No 3  
>KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton]
Probab=17.91  E-value=36  Score=38.82  Aligned_cols=87  Identities=21%  Similarity=0.202  Sum_probs=52.7

Q ss_pred             CeEEEEE-Eee----------eecccCCCCCCCCCcccCeEEEEEEeCCCCC-CCCC--eEEEEEEEecCCCCccccCCC
Q 016337          125 GGTGTER-SLT----------YYSYRHDPKPGEKPIKTHWLMREYMLKRPKN-DKES--MALCVVYFHGQRDNEDKQNSH  190 (391)
Q Consensus       125 ~vIG~KK-tLv----------FY~gr~~pk~G~~~~KTgWvMhEYrL~~~~~-~~~d--~VLCRIykK~r~~~~~k~~~~  190 (391)
                      -+||+|- .|+          |..|+. . +|   .|++.-|.||....... ...+  -|||--|+.++.-.+..+..+
T Consensus       613 pIvG~RyR~l~~fn~dlCq~CF~sgra-a-k~---hk~~~pM~Ey~~~tts~~d~rdfak~L~nkfr~~~~~a~~~rrGy  687 (966)
T KOG4286|consen  613 PIIGFRYRSLKHFNYDICQSCFFSGRA-A-KG---HKMHYPMVEYCTPTTSGEDVRDFAKVLKNKFRTKRYFAKHPRRGY  687 (966)
T ss_pred             ccceeeeeehhhcChhHHhhHhhhccc-c-cC---CCCCCCceeeeCCCCChhhHHHHHHHHHhhhccchhhhcccccCC
Confidence            4678773 332          456888 4 78   89999999999887654 1122  288888887766555544443


Q ss_pred             CCcccC----CC--CCCCCCCccccCCchhhh
Q 016337          191 PDVEAE----GS--PTRNNPALIHWDSNLEAI  216 (391)
Q Consensus       191 ~~~~~e----~s--~s~~~p~~~h~~s~~~~~  216 (391)
                      ..+...    +.  .+..-|+..|.++.+..|
T Consensus       688 lpvq~~~e~~~~et~pa~sP~~~~t~t~s~~~  719 (966)
T KOG4286|consen  688 LPVQTVLEGDNMETQPASSPQLSHTDTHSRIE  719 (966)
T ss_pred             ccchhcccccccccCccCCCCCcccchHHHHH
Confidence            322211    11  123457777777666554


No 4  
>PHA00692 hypothetical protein
Probab=15.51  E-value=58  Score=26.02  Aligned_cols=10  Identities=20%  Similarity=0.341  Sum_probs=8.3

Q ss_pred             CCCCCcceec
Q 016337           26 WKKVDGIKFK   35 (391)
Q Consensus        26 ~~LPPGfRF~   35 (391)
                      +..||||||-
T Consensus        35 veyppgfrfg   44 (74)
T PHA00692         35 VEYPPGFRFG   44 (74)
T ss_pred             EecCCCcccc
Confidence            4689999995


No 5  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=13.06  E-value=2e+02  Score=19.44  Aligned_cols=19  Identities=16%  Similarity=0.130  Sum_probs=15.7

Q ss_pred             ChHHHHHHHHHHhhcCCCC
Q 016337           37 TAEVLIFVYLAGMVSGSTD   55 (391)
Q Consensus        37 TDEELV~~YL~rKv~G~pl   55 (391)
                      +-.|||.+|+.-|+.-+..
T Consensus         4 ~nRelV~~yv~yKLsQrgy   22 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGY   22 (27)
T ss_pred             chHHHHHHHHHHHHhhcCC
Confidence            4579999999999987655


No 6  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=11.56  E-value=1.2e+02  Score=27.46  Aligned_cols=11  Identities=45%  Similarity=0.588  Sum_probs=9.2

Q ss_pred             cCChHHHHHHH
Q 016337           35 KPTAEVLIFVY   45 (391)
Q Consensus        35 ~PTDEELV~~Y   45 (391)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            49999999764


No 7  
>PF08260 Kinin:  Insect kinin peptide;  InterPro: IPR013202 This entry represents neuropeptides that are the first members of the insect kinin-family isolated from the American cockroach. Their occurrence in the retrocerebral complex suggests a physiological role as a neurohormone. The C-terminal sequence Phe-X-Ser-Trp-Gly-NH2 characterised the peptides as members of the insect kinin family. Data suggest a possible involvement of insect kinins in water-balance by regulating the osmoregulation. Insect kinins also mediate visceral muscle contractile activity (myotropic activity) []. These peptides have lengths ranging from 6 to 14 amino acids [].
Probab=11.01  E-value=1.1e+02  Score=15.38  Aligned_cols=6  Identities=67%  Similarity=1.680  Sum_probs=3.7

Q ss_pred             cccccc
Q 016337          271 TFASWG  276 (391)
Q Consensus       271 ~~~~~~  276 (391)
                      .|.|||
T Consensus         3 afnswg    8 (8)
T PF08260_consen    3 AFNSWG    8 (8)
T ss_pred             cccccC
Confidence            466775


No 8  
>cd00265 MADS_MEF2_like MEF2 (myocyte enhancer factor 2)-like/Type II subfamily of MADS ( MCM1, Agamous, Deficiens, and SRF (serum response factor) box family of eukaryotic transcriptional regulators. Binds DNA and exists as hetero and homo-dimers. Differs from SRF-like/Type I subgroup mainly in position of the alpha helix responsible for the dimerization interface. Important in homeotic regulation in plants and in immediate-early development in animals.  Also found in fungi.
Probab=10.77  E-value=1.8e+02  Score=23.51  Aligned_cols=22  Identities=27%  Similarity=0.516  Sum_probs=18.5

Q ss_pred             cCCCCccccCchhHHHHHHHhh
Q 016337          352 ADGSPYQYSSNDDIQLLEQYLF  373 (391)
Q Consensus       352 ~~~~~~~~~~~~~~~~~~~~~~  373 (391)
                      .+|.+|.|++...-+.|+.|+=
T Consensus        49 p~gk~~~f~s~s~~~vl~ry~~   70 (77)
T cd00265          49 SSGKLYEFSSPSMEKIIERYQK   70 (77)
T ss_pred             CCCceEEecCCCHHHHHHHHHh
Confidence            3589999999888889999873


No 9  
>PRK11560 phosphoethanolamine transferase; Provisional
Probab=10.39  E-value=1.6e+02  Score=32.34  Aligned_cols=30  Identities=30%  Similarity=0.680  Sum_probs=24.3

Q ss_pred             CChhhhhhhhhcCCCCCCccccccCCCCccccc
Q 016337          304 SSNSFQNMINMMGVSSAAPADSIINTPNNWCST  336 (391)
Q Consensus       304 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  336 (391)
                      .-+=|.-++.++||.   ..|.++|--||||+.
T Consensus       525 ~~dlf~TlL~~~gv~---~p~~~~~~~~~~~~~  554 (558)
T PRK11560        525 HVELFDTILGCLGYT---SPDGGINENNNWCHI  554 (558)
T ss_pred             ehhHHHHHHHHcCCC---CChhhccccCCcccC
Confidence            346688899999997   567888877999974


No 10 
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=9.86  E-value=1.9e+02  Score=17.07  Aligned_cols=8  Identities=50%  Similarity=1.331  Sum_probs=6.3

Q ss_pred             CceEEEEe
Q 016337           84 DGNMYFFS   91 (391)
Q Consensus        84 d~eWYFFs   91 (391)
                      ++.||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            47899994


Done!