Citrus Sinensis ID: 016343


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MMRPATMIRNACLRNFSQSLRVGSAFLKSGDFCRYTSQAAASLQQDCEPSAYSDDESADHMDWDNLGFGLTPADYMYTMKCSNDYFEKGRLSRYGKIELSPSSGVLNYGQGLFEGMKAYRKEDGQLVLFRPDQNAIRLQTGAERMCMPSPSIDQFIDAVKQTALANKRWVPPPGKGSLYIRPLLVGSGPILGLAPAPEYTFLVFASPVGNYFKGLAPLNLYVEDEFHRATPGGAGGVKAISNYAPVLKAISRAKNRGFSDVLYLDSVNKKNLEEVSSCNIFILKGNIISTPATSGTILAGITRKSIIEIASDCGFQVEERAIPVDELLEADEVFCTGTAVVVAPVGSITYRGKRIEFKTGAQSVSRELYSTLVGIQTGLIKDNKGWTVEIN
ccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccccEEEEccccccccccccHHHHHHHHHcccccccccccEEEEcHHHHHHHHHHcHHccccccccHHHHHHHHHHHHHHccccccccccccEEEccEEEECcccccccccccEEEEEEEEccccccccccccEEEEEccEEEccccccccccccccHHHHHHHHHHHHHccccCEEEEccccccEEEEEcccEEEEEEccEEEcccccccccccccHHHHHHHHHHccccEEEEECcccccccccEEcccccEEEEcccEEEEEccCEEEEcccccHHHHHHHHHHHHccccccccccccEEEcc
*******IRNACLRNFSQSLRVGSAFLKSGDFCRYTS***********************MDWDNLGFGLTPADYMYTMKCSNDYFEKGRLSRYGKIELSPSSGVLNYGQGLFEGMKAYRKEDGQLVLFRPDQNAIRLQTGAERMCMPSPSIDQFIDAVKQTALANKRWVPPPGKGSLYIRPLLVGSGPILGLAPAPEYTFLVFASPVGNYFKGLAPLNLYVEDEFHRATPGGAGGVKAISNYAPVLKAISRAKNRGFSDVLYLDSVNKKNLEEVSSCNIFILKGNIISTPATSGTILAGITRKSIIEIASDCGFQVEERAIPVDELLEADEVFCTGTAVVVAPVGSITYRGKRIEFKTGAQSVSRELYSTLVGIQTGLIKDNKGWTVEIN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMRPATMIRNACLRNFSQSLRVGSAFLKSGDFCRYTSQAAASLQQDCEPSAYSDDESADHMDWDNLGFGLTPADYMYTMKCSNDYFEKGRLSRYGKIELSPSSGVLNYGQGLFEGMKAYRKEDGQLVLFRPDQNAIRLQTGAERMCMPSPSIDQFIDAVKQTALANKRWVPPPGKGSLYIRPLLVGSGPILGLAPAPEYTFLVFASPVGNYFKGLAPLNLYVEDEFHRATPGGAGGVKAISNYAPVLKAISRAKNRGFSDVLYLDSVNKKNLEEVSSCNIFILKGNIISTPATSGTILAGITRKSIIEIASDCGFQVEERAIPVDELLEADEVFCTGTAVVVAPVGSITYRGKRIEFKTGAQSVSRELYSTLVGIQTGLIKDNKGWTVEIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Branched-chain-amino-acid aminotransferase 2, chloroplastic Converts 2-oxo acids to branched-chain amino acids. Acts on leucine, isoleucine and valine.confidentQ9M439
Branched-chain-amino-acid aminotransferase Catalyzes the reversible transfers of an amino group from glutamate to the alpha-ketoacid of the respective amino acid in the final step in the biosynthesis of branchedchain amino acids. The amino acids can be ranked in the following order with respect to their efficiency as amino donor: Leu > Ile > Val.probableQ10399
Branched-chain-amino-acid aminotransferase, cytosolic Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.probableP24288

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.6.-.-Transferring nitrogenous groups.probable
2.6.1.-Transaminases (aminotransferases).probable
2.6.1.42Branched-chain-amino-acid transaminase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DQN, chain A
Confidence level:very confident
Coverage over the Query: 59-391
View the alignment between query and template
View the model in PyMOL