Citrus Sinensis ID: 016346


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-
MKKGGLNPNVKLKLSLPSSEEASFTKFLTKSGTFMDGDLLVNKDGVRIVSQTETEAPPLIKPSDNQLNLEDIDTIKVVGKGSGGIVQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLYLHHEKHIIHRDLKPSNLLINHRGEVKITDFGVSAIMASTSGQANTFVGTYNYMSPERISGGKYGYKSDIWSLGLVLLECATGQFPYSPPEQQDGWTSFYELMEAIVDQPPPSAPSDQFSPEFCSFISACVQKEPQQRLSAQELMTHPFLKMYGDLNVDLSEYFTDAGSPLATLSNLSADMHGQQLRCKLFSKFGKDSQNPLSLKTNCS
cccccccccccccccccccccccccccccccccccccccCCcccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEEEccccHHHHHHHHHHHHHHHccccccEEEEEEEEEEccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEcccccEEEccccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccccccccHHHHHHHHHHHcccccccccHHHHHcccHHHccccccccHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccccccccccc
******************************************************************LNLEDIDTIKVVGKGSGGIVQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLYLHHEKHIIHRDLKPSNLLINHRGEVKITDFGVSAIMASTSGQANTFVGTYNYMSPERISGGKYGYKSDIWSLGLVLLECATGQFPYSPPEQQDGWTSFYELMEAIVDQPPPSA***QFSPEFCSFISACVQKEPQQRLSAQELMTHPFLKMYGDLNVDLSEYFTDAG*****************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKGGLNPNVKLKLSLPSSEEASFTKFLTKSGTFMDGDLLVNKDGVRIVSQTETEAPPLIKPSDNQLNLEDIDTIKVVGKGSGGIVQLVQHKWTGQFFALKVIQMNVEESARRQIAQELKINQSSQCPYVVVCYQSFYSNGAISIILEYMDGGSLADFLKKVKTIPEEYLAAICEQVLKGLLYLHHEKHIIHRDLKPSNLLINHRGEVKITDFGVSAIMASTSGQANTFVGTYNYMSPERISGGKYGYKSDIWSLGLVLLECATGQFPYSPPEQQDGWTSFYELMEAIVDQPPPSAPSDQFSPEFCSFISACVQKEPQQRLSAQELMTHPFLKMYGDLNVDLSEYFTDAGSPLATLSNLSADMHGQQLRCKLFSKFGKDSQNPLSLKTNCS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitogen-activated protein kinase kinase 2 May be involved in the cold and salinity stress-mediated MAP kinase signaling cascade (MEKK1, MEK1/MKK2 and MPK4/MPK6). Activates by phosphorylation the downstream MPK4 and MPK6.confidentQ9S7U9
Protein kinase byr1 Serine/threonine protein kinase involved in conjugation and sporulation. It is thought that it is phosphorylated by the byr2 protein kinase and that it can phosphorylate the spk1 kinase. When bound to bob1, is involved in the regulation of sexual differentiation.probableP10506

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.12.-Dual-specificity kinases (those acting on Ser/Thr and Tyr residues).probable
2.7.12.2Mitogen-activated protein kinase kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EQC, chain A
Confidence level:very confident
Coverage over the Query: 65-344
View the alignment between query and template
View the model in PyMOL
Template: 3RP9, chain A
Confidence level:very confident
Coverage over the Query: 69-380
View the alignment between query and template
View the model in PyMOL