Citrus Sinensis ID: 016415


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390
MKFVYTDTSVVPPLIYAVMGTSREIAIGPVAVVSLLLSSMIQKVQDPLANPIAYRNFVLTATFFAGIFQASFGLFRLGFLIDILSHAAVVGFMAGAAIVIGLQQLKGLIGIPHFTNKTDAISVVKAVWNSLHHTWSPQNFILGCSFLCFILTTRYLGRKKRKLFWLPAIAPLVSVILSTLFVFLTRADKHGVKIVKHIDRGLNPSSVHQIQFHGQHVGEVAKIGFVAAIVALAEAIAVGRSFASIKGYRLDGNKEMVAMGFMNIVGSFTSCYVATGSFSRSAVNFRAGCESTVSNIVMAITVLISLEFFTRLLYYTPMAILASIIMSALPGLIDFNEFYNIWKVDKLDFLACIGAFFGVLFASVEIGLLVAVIFLSCCLTNKKSEPNLWN
cccccccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
*KFVYTDTSVVPPLIYAVMGTSREIAIGPVAVVSLLLSSMIQKVQDPLANPIAYRNFVLTATFFAGIFQASFGLFRLGFLIDILSHAAVVGFMAGAAIVIGLQQLKGLIGIPHFTNKTDAISVVKAVWNSLHHTWSPQNFILGCSFLCFILTTRYLGRKKRKLFWLPAIAPLVSVILSTLFVFLTRADKHGVKIVKHIDRGLNPSSVHQIQFHGQHVGEVAKIGFVAAIVALAEAIAVGRSFASIKGYRLDGNKEMVAMGFMNIVGSFTSCYVATGSFSRSAVNFRAGCESTVSNIVMAITVLISLEFFTRLLYYTPMAILASIIMSALPGLIDFNEFYNIWKVDKLDFLACIGAFFGVLFASVEIGLLVAVIFLSCCLTNKKSEPNL**
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFVYTDTSVVPPLIYAVMGTSREIAIGPVAVVSLLLSSMIQKVQDPLANPIAYRNFVLTATFFAGIFQASFGLFRLGFLIDILSHAAVVGFMAGAAIVIGLQQLKGLIGIPHFTNKTDAISVVKAVWNSLHHTWSPQNFILGCSFLCFILTTRYLGRKKRKLFWLPAIAPLVSVILSTLFVFLTRADKHGVKIVKHIDRGLNPSSVHQIQFHGQHVGEVAKIGFVAAIVALAEAIAVGRSFASIKGYRLDGNKEMVAMGFMNIVGSFTSCYVATGSFSRSAVNFRAGCESTVSNIVMAITVLISLEFFTRLLYYTPMAILASIIMSALPGLIDFNEFYNIWKVDKLDFLACIGAFFGVLFASVEIGLLVAVIFLSCCLTNKKSEPNLWN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sulfate transporter 2.1 Low-affinity H(+)/sulfate cotransporter that may be involved in root-to-shoot translocation of sulfate. Plays a central role in the regulation of sulfate assimilation.probableO04722

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QE7, chain A
Confidence level:confident
Coverage over the Query: 5-118,132-347
View the alignment between query and template
View the model in PyMOL