Query         016435
Match_columns 389
No_of_seqs    134 out of 873
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 06:49:59 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/016435.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/016435hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0   9E-42 1.9E-46  294.3   5.2  128    3-134     1-129 (129)
  2 PHA00692 hypothetical protein   27.2      23  0.0005   28.1   0.2    9    2-10     36-44  (74)
  3 PF08483 IstB_IS21_ATP:  IstB-l  15.8 1.1E+02  0.0025   20.9   1.7   19  365-383    10-28  (30)
  4 KOG3238 Chloride ion current i  14.4 1.3E+02  0.0028   29.2   2.4   62    4-65    110-171 (216)
  5 COG5450 Transcription regulato  13.6      76  0.0017   26.6   0.5   25  260-284    52-76  (84)
  6 PLN02417 dihydrodipicolinate s  11.7 1.2E+02  0.0026   29.7   1.3   18    3-21    103-120 (280)
  7 cd00952 CHBPH_aldolase Trans-o  11.4 1.2E+02  0.0027   30.1   1.3   18    2-20    109-126 (309)
  8 KOG2590 RNA-binding protein LA  10.8 1.3E+02  0.0028   32.4   1.2   26  363-388   330-355 (448)
  9 PF07960 CBP4:  CBP4;  InterPro  10.6 1.3E+02  0.0029   27.0   1.1   11   10-20     30-40  (128)
 10 cd00954 NAL N-Acetylneuraminic  10.5 1.3E+02  0.0029   29.4   1.2   18    3-21    103-120 (288)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=9e-42  Score=294.27  Aligned_cols=128  Identities=37%  Similarity=0.611  Sum_probs=95.5

Q ss_pred             CCCCceECCChHHHHHHHHhhhcCCCCCCc-ceeEecCCCCCCCCCCCCCCCCCCCCcEEEEEeccccccCCCCcceeec
Q 016435            3 SLVGFRFHPTDEEIILLLTMKRRDPTGFSV-RTIKEIDLYSFEPRELPCHSDIQSEEEVWYFFCEPCYKNSESKRVHRRT   81 (389)
Q Consensus         3 LPpGfRF~PTDEELI~~YL~~Ki~G~plp~-~~I~evDVY~~ePweLP~~~~~~g~d~eWYFFs~r~rK~~~G~R~~R~t   81 (389)
                      |||||||+|||+|||.+||++|+.|.+++. .+|+++|||++|||+|++..  .+.+++||||+++.+++.++.|.+|++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~~--~~~~~~~yFF~~~~~~~~~~~r~~R~~   78 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAKF--KGGDEEWYFFSPRKKKYPNGGRPNRVT   78 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHHS--SS-SSEEEEEEE----------S-EEE
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhhc--cCCCceEEEEEecccccCCcccccccc
Confidence            899999999999999999999999999888 69999999999999999422  224789999999999999999999999


Q ss_pred             cCceEEecCCcceeeeCCCceEEEEEEEEeeccccCCCCCCCcCeEEEEEEeC
Q 016435           82 KEGYWKKTGRGSNINRKYKTEVIGTKKFLSFSRDDAAAQKNTTEWVIHEIAVE  134 (389)
Q Consensus        82 ggG~WKatG~~K~I~~~~gg~vIG~KKtLvFy~gr~p~~g~KT~WvMhEYsL~  134 (389)
                      ++|+||++|+.++|.+. ++.+||+|++|+||.++.+ ++.+|+|+||||+|.
T Consensus        79 ~~G~Wk~~g~~~~i~~~-~g~~iG~k~~l~f~~~~~~-~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   79 GGGYWKSTGKEKPIKDP-GGKVIGFKKTLVFYSGKSP-NGKKTGWVMHEYSLE  129 (129)
T ss_dssp             TTEEEEEECEEEEEEE--TTCEEEEEEEEEEEESSTT-S-EEEEEEEEEEEE-
T ss_pred             cceEEeecccccccccc-cceeeeeEEEEEEEeccCC-CCCcCCeEEEEEEeC
Confidence            99999999999999996 4589999999999988777 889999999999984


No 2  
>PHA00692 hypothetical protein
Probab=27.16  E-value=23  Score=28.08  Aligned_cols=9  Identities=44%  Similarity=0.763  Sum_probs=7.4

Q ss_pred             CCCCCceEC
Q 016435            2 DSLVGFRFH   10 (389)
Q Consensus         2 ~LPpGfRF~   10 (389)
                      ..||||||-
T Consensus        36 eyppgfrfg   44 (74)
T PHA00692         36 EYPPGFRFG   44 (74)
T ss_pred             ecCCCcccc
Confidence            579999995


No 3  
>PF08483 IstB_IS21_ATP:  IstB-like ATP binding N-terminal;  InterPro: IPR013690 This bacterial domain is found to the N terminus of the IPR002611 from INTERPRO-like ATP binding domain in proteins which are putative transposase subunits []. 
Probab=15.84  E-value=1.1e+02  Score=20.89  Aligned_cols=19  Identities=21%  Similarity=0.279  Sum_probs=15.3

Q ss_pred             chhhhHhHHHHhhhHHHHH
Q 016435          365 ETESFNEWVNMVFDYQILK  383 (389)
Q Consensus       365 ~~~~~~~~~~~~~~~~~~~  383 (389)
                      ..-||.||+.+..|-.+..
T Consensus        10 ~~LsFeERl~LLvdrE~~~   28 (30)
T PF08483_consen   10 QELSFEERLGLLVDREWTW   28 (30)
T ss_pred             hhcCHHHHHHHHHHHHHHh
Confidence            4568999999999877654


No 4  
>KOG3238 consensus Chloride ion current inducer protein [Inorganic ion transport and metabolism]
Probab=14.41  E-value=1.3e+02  Score=29.19  Aligned_cols=62  Identities=18%  Similarity=0.243  Sum_probs=36.6

Q ss_pred             CCCceECCChHHHHHHHHhhhcCCCCCCcceeEecCCCCCCCCCCCCCCCCCCCCcEEEEEe
Q 016435            4 LVGFRFHPTDEEIILLLTMKRRDPTGFSVRTIKEIDLYSFEPRELPCHSDIQSEEEVWYFFC   65 (389)
Q Consensus         4 PpGfRF~PTDEELI~~YL~~Ki~G~plp~~~I~evDVY~~ePweLP~~~~~~g~d~eWYFFs   65 (389)
                      --+|||.|+|.--+.-.-.-.....-+-+....+.+-|.-+=|+..+....+|+...||=+.
T Consensus       110 i~e~rfvpsDk~~l~a~f~qfcecqel~p~P~ED~~~~dgee~~mea~d~~~gDs~~~~t~d  171 (216)
T KOG3238|consen  110 ITEFRFVPSDKSALEAMFTQFCECQELNPDPDEDEDDYDGEEYDMEAHDAGQGDSPNSYTYD  171 (216)
T ss_pred             cccceecCCchhHHHHHHHHHHhhhhcCCCccccccccccchhhhhhhhccCCCCccccccc
Confidence            35899999998766643334444443322235666677777777754444445555665543


No 5  
>COG5450 Transcription regulator of the Arc/MetJ class [Transcription]
Probab=13.61  E-value=76  Score=26.63  Aligned_cols=25  Identities=36%  Similarity=0.356  Sum_probs=21.4

Q ss_pred             hHHHHHhHHHhhcCCCCCCCCcccc
Q 016435          260 EAETRRLAELNRRGDGYDGRNDASV  284 (389)
Q Consensus       260 ~~~~~~~~~~~~~~~~~~~~~~~~~  284 (389)
                      |+.++.|..++++++|+.|+||--.
T Consensus        52 e~~~r~l~~~~~~~~g~~~~~~~V~   76 (84)
T COG5450          52 ERGTRILLLRALRAVGFTGDNDRVD   76 (84)
T ss_pred             ccchhHHHhhhhhhccccCchHHHH
Confidence            7778888899999999999998543


No 6  
>PLN02417 dihydrodipicolinate synthase
Probab=11.65  E-value=1.2e+02  Score=29.70  Aligned_cols=18  Identities=11%  Similarity=0.041  Sum_probs=14.6

Q ss_pred             CCCCceECCChHHHHHHHH
Q 016435            3 SLVGFRFHPTDEEIILLLT   21 (389)
Q Consensus         3 LPpGfRF~PTDEELI~~YL   21 (389)
                      +|| +.|.||+++|+.||-
T Consensus       103 ~~P-~y~~~~~~~i~~~f~  120 (280)
T PLN02417        103 INP-YYGKTSQEGLIKHFE  120 (280)
T ss_pred             cCC-ccCCCCHHHHHHHHH
Confidence            566 568999999999774


No 7  
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=11.35  E-value=1.2e+02  Score=30.13  Aligned_cols=18  Identities=0%  Similarity=-0.119  Sum_probs=14.8

Q ss_pred             CCCCCceECCChHHHHHHH
Q 016435            2 DSLVGFRFHPTDEEIILLL   20 (389)
Q Consensus         2 ~LPpGfRF~PTDEELI~~Y   20 (389)
                      -+|| |.|.||+++|+.||
T Consensus       109 v~~P-~y~~~~~~~l~~yf  126 (309)
T cd00952         109 LGRP-MWLPLDVDTAVQFY  126 (309)
T ss_pred             ECCC-cCCCCCHHHHHHHH
Confidence            4677 66899999999976


No 8  
>KOG2590 consensus RNA-binding protein LARP/SRO9 and related La domain proteins [Posttranslational modification, protein turnover, chaperones; Translation, ribosomal structure and biogenesis]
Probab=10.79  E-value=1.3e+02  Score=32.39  Aligned_cols=26  Identities=12%  Similarity=0.227  Sum_probs=22.7

Q ss_pred             CcchhhhHhHHHHhhhHHHHHHhhhc
Q 016435          363 NSETESFNEWVNMVFDYQILKEDIRS  388 (389)
Q Consensus       363 ~~~~~~~~~~~~~~~~~~~~~~~~~~  388 (389)
                      -+-...|+.|++|-+||++|-+|+|.
T Consensus       330 l~~ia~F~r~ad~s~d~nli~~alr~  355 (448)
T KOG2590|consen  330 LRVIAKFKRVADLSSDINLILAALRN  355 (448)
T ss_pred             hhhhhhhhhhhhcccCHHHHHHHHhh
Confidence            44567899999999999999999985


No 9  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=10.58  E-value=1.3e+02  Score=27.02  Aligned_cols=11  Identities=36%  Similarity=0.582  Sum_probs=9.3

Q ss_pred             CCChHHHHHHH
Q 016435           10 HPTDEEIILLL   20 (389)
Q Consensus        10 ~PTDEELI~~Y   20 (389)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            49999999865


No 10 
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=10.53  E-value=1.3e+02  Score=29.36  Aligned_cols=18  Identities=17%  Similarity=-0.147  Sum_probs=13.7

Q ss_pred             CCCCceECCChHHHHHHHH
Q 016435            3 SLVGFRFHPTDEEIILLLT   21 (389)
Q Consensus         3 LPpGfRF~PTDEELI~~YL   21 (389)
                      +||- .|.||++||+.||.
T Consensus       103 ~~P~-y~~~~~~~i~~~~~  120 (288)
T cd00954         103 ITPF-YYKFSFEEIKDYYR  120 (288)
T ss_pred             eCCC-CCCCCHHHHHHHHH
Confidence            4554 47899999999764


Done!