Citrus Sinensis ID: 016445

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39

MRRSHARTRINSNMDPIKLHTRPLTRSTNLFSRNPKPTKSNPSSFAIPIALTATLITLISCYYVFIHAAKPSFPPSSVKYGVLLDGGSTGTRIHVFSYDTETNHFDFDLGSMRLNPGLSSYAVNPTNAGDSLKDLLDFAKRKVPPAFWADTEIRLMATAGLRLVDVVVQDKILDSCRRVLRVSGFRFADDWATVITGSDEGVYAWIVANYALGTLGGDPSETTGIIELGGASVQVTFVSDEPLPQEFSRTLKFGNVTYNLYSHSFLHFGQNVAFETLRELLSSGDFNTAAESLQKGTYIDPCSPKGYLHHVESSPGSLAAKIDLSTLQAGGNFSECRSAALTLLQNGKEKCSYKSCYLGSTFMPKLRGKFLATENFFHTSKVSFSHFDR

ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEccEEccccHHHHHHHHHHHHHHHHccccccccccEEEcccccccHHHHHHHHHHcccccccccccEEEEEccccEEEEEEEccccccccccEEEEEccCEEEEEEEEcccccHHHHHHHHHHHHHccccccccccccccCECcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEcccccccccccccc

********************************************FAIPIALTATLITLISCYYVFIHAAKPSFPPSSVKYGVLLDGGSTGTRIHVFSYDTETNHFDFDLGSMRLNPGLSSYAVNPTNAGDSLKDLLDFAKRKVPPAFWADTEIRLMATAGLRLVDVVVQDKILDSCRRVLRVSGFRFADDWATVITGSDEGVYAWIVANYALGTLGGDPSETTGIIELGGASVQVTFVSDEPLPQEFSRTLKFGNVTYNLYSHSFLHFGQNVAFETLRELLSSGDFNTAAESLQKGTYIDPCSPKGYLHHVESSP**LAAKIDLSTLQAGGNFSECRSAALTLLQNGKEKCSYKSCYLGSTFMPKLRGKFLATENFFHTSKVSFSHFDR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable apyrase 6	Catalyzes the hydrolysis of phosphoanhydride bonds of nucleoside tri- and di-phosphates (By similarity). Involved in the regulation of pollen and anther development.	probable	O80612

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZX3, chain A
Confidence level:very confident
Coverage over the Query: 77-384
View the alignment between query and template
View the model in PyMOL