BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016447
(389 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From
Xanthomonas Oryzae Pv. Oryzae Kacc10331
Length = 171
Score = 29.3 bits (64), Expect = 3.6, Method: Compositional matrix adjust.
Identities = 19/67 (28%), Positives = 27/67 (40%), Gaps = 19/67 (28%)
Query: 72 NNPIEPLSDSLMGESNRARLPEFVGGFDRDWEVLDTCLNADDLKLVASAYKFLQNRGFLP 131
N IEPLSD + + WE CL+ L+ V Y++++ RGF P
Sbjct: 82 NAQIEPLSDEM----------------ENGWE---GCLSIPGLRAVIPRYRYIRYRGFAP 122
Query: 132 SFGKFNR 138
R
Sbjct: 123 DGSPIER 129
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.136 0.405
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,074,534
Number of Sequences: 62578
Number of extensions: 443244
Number of successful extensions: 832
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 828
Number of HSP's gapped (non-prelim): 9
length of query: 389
length of database: 14,973,337
effective HSP length: 101
effective length of query: 288
effective length of database: 8,652,959
effective search space: 2492052192
effective search space used: 2492052192
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)