Query         016447
Match_columns 389
No_of_seqs    142 out of 817
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 06:56:29 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/016447.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/016447hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0734 AAA+-type ATPase conta 100.0 5.3E-30 1.1E-34  264.9  12.2  157  206-375   536-724 (752)
  2 PF01434 Peptidase_M41:  Peptid 100.0 4.5E-29 9.8E-34  232.8  17.4  157  206-375     7-206 (213)
  3 CHL00176 ftsH cell division pr  99.9 1.6E-26 3.4E-31  246.4  17.8  164  206-383   418-625 (638)
  4 PRK10733 hflB ATP-dependent me  99.9 2.8E-26 6.1E-31  244.4  18.0  165  206-383   387-595 (644)
  5 COG0465 HflB ATP-dependent Zn   99.9 1.9E-26   4E-31  243.0  13.9  157  206-375   385-580 (596)
  6 TIGR01241 FtsH_fam ATP-depende  99.9 2.4E-24 5.2E-29  222.3  17.4  157  206-375   290-486 (495)
  7 KOG0731 AAA+-type ATPase conta  99.9 1.2E-22 2.7E-27  218.2  12.2  163  206-383   548-748 (774)
  8 CHL00206 ycf2 Ycf2; Provisiona  98.8 7.3E-09 1.6E-13  120.8   7.4  108  206-326  1872-1992(2281)
  9 cd06163 S2P-M50_PDZ_RseP-like   97.0  0.0011 2.4E-08   61.6   5.3   24  231-254    11-34  (182)
 10 cd06164 S2P-M50_SpoIVFB_CBS Sp  96.5  0.0024 5.2E-08   61.1   4.1   60  231-311    55-114 (227)
 11 cd06161 S2P-M50_SpoIVFB SpoIVF  96.4  0.0027 5.8E-08   59.7   3.4   60  231-311    40-99  (208)
 12 PRK10779 zinc metallopeptidase  96.2  0.0046   1E-07   64.2   4.1   26  231-256    17-42  (449)
 13 cd05709 S2P-M50 Site-2 proteas  96.2  0.0032   7E-08   56.9   2.6   75  231-311    10-91  (180)
 14 PF13398 Peptidase_M50B:  Pepti  96.1  0.0059 1.3E-07   57.2   3.9   27  231-257    24-50  (200)
 15 TIGR00054 RIP metalloprotease   95.9  0.0067 1.5E-07   62.7   3.9   22  231-252    16-37  (420)
 16 PF02163 Peptidase_M50:  Peptid  95.7  0.0092   2E-07   54.2   3.5   24  232-255    10-33  (192)
 17 cd06162 S2P-M50_PDZ_SREBP Ster  94.9   0.025 5.4E-07   56.2   3.9   67  231-311   137-203 (277)
 18 cd06160 S2P-M50_like_2 Unchara  94.2   0.038 8.2E-07   51.5   3.1   27  231-257    43-69  (183)
 19 cd06159 S2P-M50_PDZ_Arch Uncha  92.3   0.056 1.2E-06   53.2   1.1   66  231-310   120-185 (263)
 20 cd06158 S2P-M50_like_1 Unchara  89.4    0.26 5.7E-06   45.6   2.5   75  232-310    12-96  (181)
 21 PF14247 DUF4344:  Domain of un  83.2    0.84 1.8E-05   44.0   2.4   19  231-250    94-112 (220)
 22 PF00413 Peptidase_M10:  Matrix  80.5    0.81 1.8E-05   39.6   1.2   16  226-241   102-117 (154)
 23 cd04279 ZnMc_MMP_like_1 Zinc-d  77.3     1.4 3.1E-05   38.9   1.8   17  226-242   101-117 (156)
 24 cd04268 ZnMc_MMP_like Zinc-dep  73.6     2.1 4.6E-05   37.5   1.9   16  226-241    91-106 (165)
 25 cd04278 ZnMc_MMP Zinc-dependen  69.1     2.2 4.8E-05   37.8   1.0   16  226-241   104-119 (157)
 26 PF02031 Peptidase_M7:  Strepto  67.2     3.7 8.1E-05   36.9   2.0   15  227-241    75-89  (132)
 27 cd04277 ZnMc_serralysin_like Z  65.0     4.1 8.9E-05   37.0   1.9   17  226-242   110-126 (186)
 28 PF04298 Zn_peptidase_2:  Putat  61.5     4.2 9.1E-05   39.5   1.3   13  231-243    91-103 (222)
 29 COG0750 Predicted membrane-ass  60.8     6.6 0.00014   39.2   2.6   26  231-256    15-40  (375)
 30 KOG2921 Intramembrane metallop  59.8       7 0.00015   41.2   2.7   25  232-256   134-158 (484)
 31 cd04327 ZnMc_MMP_like_3 Zinc-d  58.3     6.3 0.00014   36.6   1.9   17  228-244    91-107 (198)
 32 smart00235 ZnMc Zinc-dependent  56.7     5.5 0.00012   34.3   1.1   11  231-241    88-98  (140)
 33 PF05572 Peptidase_M43:  Pregna  51.2     6.8 0.00015   35.5   0.8   16  226-241    66-81  (154)
 34 PF13812 PPR_3:  Pentatricopept  49.7      24 0.00053   22.3   3.1   28  104-131     7-34  (34)
 35 cd00203 ZnMc Zinc-dependent me  46.4      10 0.00023   33.1   1.3   16  227-242    94-109 (167)
 36 PF06114 DUF955:  Domain of unk  44.6      22 0.00047   28.5   2.8   23  224-246    37-59  (122)
 37 PF07035 Mic1:  Colon cancer-as  41.4      97  0.0021   28.8   6.8   63   42-129    83-151 (167)
 38 PF13582 Reprolysin_3:  Metallo  35.0      19 0.00041   30.1   1.0   12  230-241   108-119 (124)
 39 smart00762 Cog4 COG4 transport  33.7      32 0.00069   34.7   2.6   21   47-67     13-33  (324)
 40 PF13485 Peptidase_MA_2:  Pepti  33.3      43 0.00093   27.0   2.9   23  225-247    21-43  (128)
 41 TIGR00756 PPR pentatricopeptid  29.7      89  0.0019   19.2   3.4   29  104-132     6-34  (35)
 42 PF07998 Peptidase_M54:  Peptid  27.9      30 0.00065   33.0   1.2   11  231-241   147-157 (194)
 43 cd06258 Peptidase_M3_like The   27.7      33 0.00072   34.3   1.6   22  227-248   152-173 (365)
 44 cd04280 ZnMc_astacin_like Zinc  26.8      32  0.0007   31.6   1.2   14  230-243    75-88  (180)
 45 PF01400 Astacin:  Astacin (Pep  26.6      41 0.00089   31.2   1.9   16  229-244    79-94  (191)
 46 PF12388 Peptidase_M57:  Dual-a  26.0      46 0.00099   32.2   2.1   20  224-243   128-147 (211)
 47 PF12994 DUF3878:  Domain of un  25.9      14  0.0003   37.5  -1.5   17  227-243    92-108 (299)
 48 COG2738 Predicted Zn-dependent  24.1      40 0.00087   32.7   1.3   13  231-243    94-106 (226)
 49 PF11350 DUF3152:  Protein of u  24.0      38 0.00083   32.6   1.1   18  226-244   136-153 (203)
 50 PF01535 PPR:  PPR repeat;  Int  23.7 1.1E+02  0.0024   18.6   3.0   26  104-129     6-31  (31)
 51 PF10579 Rapsyn_N:  Rapsyn N-te  23.1      77  0.0017   26.4   2.6   18   38-55     47-64  (80)
 52 cd04283 ZnMc_hatching_enzyme Z  23.0      44 0.00096   31.3   1.4   16  230-245    78-93  (182)
 53 PRK13379 protocatechuate 4,5-d  23.0 1.3E+02  0.0029   26.8   4.2   33   33-65     38-76  (119)
 54 PF13583 Reprolysin_4:  Metallo  22.4      44 0.00096   31.4   1.2   15  231-245   139-153 (206)
 55 cd04281 ZnMc_BMP1_TLD Zinc-dep  21.9      47   0.001   31.5   1.3   15  231-245    89-103 (200)
 56 COG0501 HtpX Zn-dependent prot  21.8      64  0.0014   31.0   2.2   25  222-246   150-174 (302)
 57 cd04276 ZnMc_MMP_like_2 Zinc-d  21.6      59  0.0013   30.8   1.9   30   17-51      8-37  (197)
 58 PRK13267 archaemetzincin-like   21.4      52  0.0011   30.8   1.4   11  231-241   127-137 (179)
 59 cd03569 VHS_Hrs_Vps27p VHS dom  21.2      96  0.0021   27.7   3.1   27  101-129   111-137 (142)
 60 COG5549 Predicted Zn-dependent  21.1      49  0.0011   32.4   1.2   19  224-242   182-200 (236)
 61 cd04275 ZnMc_pappalysin_like Z  20.8      15 0.00033   35.4  -2.3   18  226-243   134-151 (225)
 62 PF01435 Peptidase_M48:  Peptid  20.8      71  0.0015   29.0   2.2   24  224-247    84-107 (226)

No 1  
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]
Probab=99.96  E-value=5.3e-30  Score=264.90  Aligned_cols=157  Identities=20%  Similarity=0.202  Sum_probs=134.8

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecchhhhhcCccccccceecchhhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELA  283 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~  283 (389)
                      .+-|||+||.+++.+  .++++.|+.+||||+|||+||+.+.  .|++|+||.|     ||.  +.|.+.+.|++|++  
T Consensus       536 ~akDrIlMG~ERks~--~i~~eak~~TAyHE~GHAivA~yTk~A~PlhKaTImP-----RG~--sLG~t~~LPe~D~~--  604 (752)
T KOG0734|consen  536 FAKDRILMGPERKSM--VIDEEAKKITAYHEGGHAIVALYTKGAMPLHKATIMP-----RGP--SLGHTSQLPEKDRY--  604 (752)
T ss_pred             hhhhheeeccccccc--ccChhhhhhhhhhccCceEEEeecCCCccccceeecc-----CCc--cccceeecCccchh--
Confidence            579999999987544  4689999999999999999999997  5999999999     885  78999999988765  


Q ss_pred             ccCCCHHHHHHHHHHHchHHHHHHHHhCC---CcchHhHHHHHH----HHHHHhCCC----------------c---cHH
Q 016447          284 EGRLSGTAFDRYSMVLFAGIAAEALIYGE---AEGGENDENLFR----SICVLLQPP----------------L---SMA  337 (389)
Q Consensus       284 ~g~lT~~~L~~~i~VlLAGrAAEeLvfGe---atGgsnDL~~ar----~m~~~lG~~----------------~---s~~  337 (389)
                        .+|+.++..++-|+||||+||+|+||.   ++|+++|+++++    +|++.+|++                +   ++.
T Consensus       605 --~~Tk~q~LA~lDV~MGGRvAEELIfG~D~iTsGAssDl~qAT~lA~~MVt~fGMSd~vG~v~~~~~~~~~s~~~~t~~  682 (752)
T KOG0734|consen  605 --SITKAQLLARLDVCMGGRVAEELIFGTDKITSGASSDLDQATKLARRMVTKFGMSDKVGPVTLSAEDNSSSLSPRTQE  682 (752)
T ss_pred             --hHHHHHHHHHHHHhhcchHHHHHhccCCcccccccchHHHHHHHHHHHHHHcCccccccceeeeccCCCCCCCchhHH
Confidence              579999999999999999999999996   479999999985    666666631                1   222


Q ss_pred             HHH----HHHHHHHHHHHHHHHHcHHHHHHHHHHHHhcCcHH
Q 016447          338 QMS----NQARWAVLQSYNLLKWHKHAHLEAVKALESGSSLS  375 (389)
Q Consensus       338 ~id----~~vr~A~~rA~~LLrehr~aLe~LAeaLle~ETL~  375 (389)
                      .||    +.++.+|+||+.||+.|.+.+++||++|+++|||+
T Consensus       683 lidaEi~~lL~~sYeRak~iL~~h~kEl~~LA~ALleYETL~  724 (752)
T KOG0734|consen  683 LIDAEIKRLLRDSYERAKSILKTHKKELHALAEALLEYETLD  724 (752)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCC
Confidence            345    44567999999999999999999999999999994


No 2  
>PF01434 Peptidase_M41:  Peptidase family M41 This is family M41 in the peptidase classification. ;  InterPro: IPR000642 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M41 (FtsH endopeptidase family, clan MA(E)). The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The peptidase M41 family belong to a larger family of zinc metalloproteases. This family includes the cell division protein FtsH, and the yeast mitochondrial respiratory chain complexes assembly protein, which is a putative ATP-dependent protease required for assembly of the mitochondrial respiratory chain and ATPase complexes. FtsH is an integral membrane protein, which seems to act as an ATP-dependent zinc metallopeptidase that binds one zinc ion.; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0006508 proteolysis; PDB: 4EIW_C 2DHR_E 1IY1_A 1IY2_A 1IY0_A 1IXZ_A 2CE7_F 2CEA_F 3KDS_E 2QZ4_A ....
Probab=99.96  E-value=4.5e-29  Score=232.85  Aligned_cols=157  Identities=25%  Similarity=0.314  Sum_probs=121.4

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecchhhhhcCccccccceecchhhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELA  283 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~  283 (389)
                      -++|+|++|.....  ..+++++|+|+||||||||+|+++++  .||.++||+|     +|.  .+|++...|..++.  
T Consensus         7 ~a~drv~~G~~~~~--~~~~~~~~~~~A~HEAGhAvva~~l~~~~~v~~vsi~p-----rg~--~~G~~~~~~~~~~~--   75 (213)
T PF01434_consen    7 EAIDRVLMGPEKKS--RKLSEEEKRRIAYHEAGHAVVAYLLPPADPVSKVSIVP-----RGS--ALGFTQFTPDEDRY--   75 (213)
T ss_dssp             HHHHHHHCCSCCTT--S---HHHHHHHHHHHHHHHHHHHHSSS---EEEEESST-----TCC--CCHCCEECHHTT-S--
T ss_pred             HHHHHHhcCcCcCC--CCCCHHHHHHHHHHHHHHHHHHHHhcccccEEEEEEec-----CCC--cceeEEeccchhcc--
Confidence            37999999987422  35689999999999999999999998  6999999999     774  55666666654432  


Q ss_pred             ccCCCHHHHHHHHHHHchHHHHHHHHhC--C-CcchHhHHHHHHHH----HHHhCC-------C----------------
Q 016447          284 EGRLSGTAFDRYSMVLFAGIAAEALIYG--E-AEGGENDENLFRSI----CVLLQP-------P----------------  333 (389)
Q Consensus       284 ~g~lT~~~L~~~i~VlLAGrAAEeLvfG--e-atGgsnDL~~ar~m----~~~lG~-------~----------------  333 (389)
                        ..|++++.+.++|+|||||||+++||  + ++|+++|+++|+.+    +..+|+       .                
T Consensus        76 --~~t~~~l~~~i~v~LaGraAEe~~~g~~~~stGa~~DL~~At~iA~~mv~~~Gm~~~~g~~~~~~~~~~~~~~~~~~~  153 (213)
T PF01434_consen   76 --IRTRSYLEDRICVLLAGRAAEELFFGEDNVSTGASSDLQQATEIARKMVASYGMGDSLGLLSYSPNDDDEVFLGREWN  153 (213)
T ss_dssp             --S-BHHHHHHHHHHHHHHHHHHHHHHSCCS-BGGGHHHHHHHHHHHHHHHHTST-TTTTTSS-SEEEE-S-SSS-E---
T ss_pred             --cccHHHHHhhHHHHHHHHHHHHhhcCcceecccchhHHHHHHHHHHHHHHHhCCCCCCceeeeecccccccccccccc
Confidence              36999999999999999999999999  4 57889999998755    333332       0                


Q ss_pred             ----cc---HHHHH----HHHHHHHHHHHHHHHHcHHHHHHHHHHHHhcCcHH
Q 016447          334 ----LS---MAQMS----NQARWAVLQSYNLLKWHKHAHLEAVKALESGSSLS  375 (389)
Q Consensus       334 ----~s---~~~id----~~vr~A~~rA~~LLrehr~aLe~LAeaLle~ETL~  375 (389)
                          ++   ...++    ..++.+|.+|++||++|++.+++||++|+++++|+
T Consensus       154 ~~~~~s~~~~~~i~~ev~~lL~~a~~~a~~iL~~~r~~l~~la~~Lle~~~L~  206 (213)
T PF01434_consen  154 SRRPMSEETRALIDREVRKLLEEAYARAKEILEENREALEALAEALLEKETLS  206 (213)
T ss_dssp             EEESS-HHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHSEEE
T ss_pred             ccCCcchhhHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhCeeC
Confidence                11   12344    44567999999999999999999999999999983


No 3  
>CHL00176 ftsH cell division protein; Validated
Probab=99.94  E-value=1.6e-26  Score=246.35  Aligned_cols=164  Identities=19%  Similarity=0.234  Sum_probs=133.7

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecchhhhhcCccccccceecchhhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELA  283 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~  283 (389)
                      .++|++++|....   ...++++|++|||||||||+|+++++  +||+++||+|     ||.  ++|+++..|+.+++  
T Consensus       418 ~Ai~rv~~g~~~~---~~~~~~~~~~vA~hEaGhA~v~~~l~~~~~v~kvtI~p-----rg~--~~G~~~~~p~~~~~--  485 (638)
T CHL00176        418 TAIDRVIAGLEGT---PLEDSKNKRLIAYHEVGHAIVGTLLPNHDPVQKVTLIP-----RGQ--AKGLTWFTPEEDQS--  485 (638)
T ss_pred             HHHHHHHhhhccC---ccccHHHHHHHHHHhhhhHHHHhhccCCCceEEEEEee-----cCC--CCCceEecCCcccc--
Confidence            4689999997632   23578999999999999999999997  7999999999     773  67888888876554  


Q ss_pred             ccCCCHHHHHHHHHHHchHHHHHHHHhCC---CcchHhHHHHHHH----HHHHhCCC-----------------------
Q 016447          284 EGRLSGTAFDRYSMVLFAGIAAEALIYGE---AEGGENDENLFRS----ICVLLQPP-----------------------  333 (389)
Q Consensus       284 ~g~lT~~~L~~~i~VlLAGrAAEeLvfGe---atGgsnDL~~ar~----m~~~lG~~-----------------------  333 (389)
                        .+|+.++.+.++++|||||||+++||+   ++|++||+++|+.    |+..+|+.                       
T Consensus       486 --~~t~~~l~~~i~~~LgGraAE~~~fg~~~~~~Ga~~Dl~~AT~iA~~mv~~~Gm~~~g~~~~~~~~~~~~~~~~~~~~  563 (638)
T CHL00176        486 --LVSRSQILARIVGALGGRAAEEVVFGSTEVTTGASNDLQQVTNLARQMVTRFGMSSIGPISLESNNSTDPFLGRFMQR  563 (638)
T ss_pred             --cccHHHHHHHHHHHhhhHHHHHHhcCCCCcCCCchhHHHHHHHHHHHHHHHhCCCcCCceeecCCCCccccccccccc
Confidence              479999999999999999999999995   5799999999864    44444431                       


Q ss_pred             ---cc---HHHHHHH----HHHHHHHHHHHHHHcHHHHHHHHHHHHhcCcH--HHHHHHHHH
Q 016447          334 ---LS---MAQMSNQ----ARWAVLQSYNLLKWHKHAHLEAVKALESGSSL--SVVIRRIEE  383 (389)
Q Consensus       334 ---~s---~~~id~~----vr~A~~rA~~LLrehr~aLe~LAeaLle~ETL--~~Ci~~IE~  383 (389)
                         ++   ..++|.+    ++.||.+|++||++|++.+++||++|+++|||  +++.++++.
T Consensus       564 ~~~~s~~~~~~iD~ev~~~l~~~~~~a~~iL~~~~~~l~~la~~Lle~Etl~~~ei~~il~~  625 (638)
T CHL00176        564 NSEYSEEIADKIDMEVRSILHTCYQYAYQILKDNRVLIDLLVELLLQKETIDGDEFREIVNS  625 (638)
T ss_pred             ccCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhCccCHHHHHHHHhh
Confidence               12   2335544    56799999999999999999999999999999  556677765


No 4  
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed
Probab=99.94  E-value=2.8e-26  Score=244.39  Aligned_cols=165  Identities=20%  Similarity=0.230  Sum_probs=132.2

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecchhhhhcCccccccceecchhhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELA  283 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~  283 (389)
                      -++|+|.+|...  +...+++++|+++||||+|||+|+++++  +||+++||+|     ||.  ++|+++..|+.++.  
T Consensus       387 ~a~~~v~~g~~~--~~~~~~~~~~~~~a~he~gha~~~~~~~~~~~~~~v~i~p-----rg~--~~g~~~~~~~~~~~--  455 (644)
T PRK10733        387 KAKDKIMMGAER--RSMVMTEAQKESTAYHEAGHAIIGRLVPEHDPVHKVTIIP-----RGR--ALGVTFFLPEGDAI--  455 (644)
T ss_pred             HHHHHHhccccc--ccccccHHHHHHHHHHHHHHHHHHHHccCCCceeEEEEec-----cCC--CcceeEECCCcccc--
Confidence            468999998753  2224678999999999999999999997  7999999999     773  67888888865543  


Q ss_pred             ccCCCHHHHHHHHHHHchHHHHHHHHhCC---CcchHhHHHHHHH----HHHHhCCC-----------------------
Q 016447          284 EGRLSGTAFDRYSMVLFAGIAAEALIYGE---AEGGENDENLFRS----ICVLLQPP-----------------------  333 (389)
Q Consensus       284 ~g~lT~~~L~~~i~VlLAGrAAEeLvfGe---atGgsnDL~~ar~----m~~~lG~~-----------------------  333 (389)
                        ..|+++++++++|+|||||||+++||.   ++|++||+++|+.    |+.++|+.                       
T Consensus       456 --~~~~~~l~~~i~~~lgGraAE~~~~g~~~~ttGa~~Dl~~AT~lA~~mv~~~Gms~~lg~~~~~~~~~~~~lg~~~~~  533 (644)
T PRK10733        456 --SASRQKLESQISTLYGGRLAEEIIYGPEHVSTGASNDIKVATNLARNMVTQWGFSEKLGPLLYAEEEGEVFLGRSVAK  533 (644)
T ss_pred             --cccHHHHHHHHHHHHhhHHHHHHHhCCCCCCCCcHHHHHHHHHHHHHHHHHhCCCccccchhhccccccccccccccc
Confidence              368999999999999999999999994   5799999999864    54445431                       


Q ss_pred             ---cc---HHHHHH----HHHHHHHHHHHHHHHcHHHHHHHHHHHHhcCcHH--HHHHHHHH
Q 016447          334 ---LS---MAQMSN----QARWAVLQSYNLLKWHKHAHLEAVKALESGSSLS--VVIRRIEE  383 (389)
Q Consensus       334 ---~s---~~~id~----~vr~A~~rA~~LLrehr~aLe~LAeaLle~ETL~--~Ci~~IE~  383 (389)
                         ++   ...+|+    .++.+|.+|++||++|++.+++||++|+++|||+  ++.+++..
T Consensus       534 ~~~~s~~~~~~id~ev~~il~~~~~~a~~iL~~~~~~l~~la~~Lle~etl~~~ei~~i~~~  595 (644)
T PRK10733        534 AKHMSDETARIIDQEVKALIERNYNRARQLLTDNMDILHAMKDALMKYETIDAPQIDDLMAR  595 (644)
T ss_pred             ccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhceeCHHHHHHHHhc
Confidence               12   223454    4567999999999999999999999999999983  44455553


No 5  
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]
Probab=99.94  E-value=1.9e-26  Score=243.01  Aligned_cols=157  Identities=23%  Similarity=0.263  Sum_probs=134.2

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecchhhhhcCccccccceecchhhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELA  283 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~  283 (389)
                      -++|+|++|.+...+  .+++++|+.+||||+||++|+++++  +||+|+||+|     ||  .++|+++..|++|+   
T Consensus       385 ea~drv~~G~erks~--vise~ek~~~AYhEaghalv~~~l~~~d~v~KvtIiP-----rG--~alG~t~~~Pe~d~---  452 (596)
T COG0465         385 EAIDRVIAGPERKSR--VISEAEKKITAYHEAGHALVGLLLPDADPVHKVTIIP-----RG--RALGYTLFLPEEDK---  452 (596)
T ss_pred             HHHHHHhcCcCcCCc--ccChhhhcchHHHHHHHHHHHHhCCCCcccceeeecc-----Cc--hhhcchhcCCcccc---
Confidence            479999999986544  5889999999999999999999998  5999999999     88  47899999997654   


Q ss_pred             ccCCCHHHHHHHHHHHchHHHHHHHHhC-C-CcchHhHHHHHH----HHHHHhCCC------------------------
Q 016447          284 EGRLSGTAFDRYSMVLFAGIAAEALIYG-E-AEGGENDENLFR----SICVLLQPP------------------------  333 (389)
Q Consensus       284 ~g~lT~~~L~~~i~VlLAGrAAEeLvfG-e-atGgsnDL~~ar----~m~~~lG~~------------------------  333 (389)
                       +.+|++++.+.++++|||||||+++|| + ++|++||+++++    .|++++|.+                        
T Consensus       453 -~l~sk~~l~~~i~~~lgGRaAEel~~g~e~ttGa~~D~~~at~~ar~mVt~~Gms~~lG~v~~~~~~~~flg~~~~~~~  531 (596)
T COG0465         453 -YLMSKEELLDRIDVLLGGRAAEELIFGYEITTGASNDLEKATDLARAMVTEYGMSAKLGPVAYEQVEGVFLGRYQKAKN  531 (596)
T ss_pred             -ccccHHHHHHHHHHHhCCcHhhhhhhcccccccchhhHHHHHHHHHHhhhhcCcchhhCceehhhcccccccccccccC
Confidence             567999999999999999999999999 7 469999999875    555555531                        


Q ss_pred             cc---HHHHHHHH----HHHHHHHHHHHHHcHHHHHHHHHHHHhcCcHH
Q 016447          334 LS---MAQMSNQA----RWAVLQSYNLLKWHKHAHLEAVKALESGSSLS  375 (389)
Q Consensus       334 ~s---~~~id~~v----r~A~~rA~~LLrehr~aLe~LAeaLle~ETL~  375 (389)
                      +|   .+.||+++    ..+|.++++||.+|++.++.++++|+++||++
T Consensus       532 ~Se~ta~~ID~evk~ii~~~y~~a~~il~~~~~~l~~~~~~Lle~Eti~  580 (596)
T COG0465         532 YSEETAQEIDREVKDIIDEAYERAKELLNENKDALETLAEMLLEKETID  580 (596)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhccC
Confidence            33   24466655    45999999999999999999999999999973


No 6  
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH. HflB(FtsH) is a pleiotropic protein required for correct cell division in bacteria. It has ATP-dependent zinc metalloprotease activity. It was formerly designated cell division protein FtsH.
Probab=99.92  E-value=2.4e-24  Score=222.32  Aligned_cols=157  Identities=22%  Similarity=0.235  Sum_probs=126.2

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecchhhhhcCccccccceecchhhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELA  283 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~  283 (389)
                      .+++++.+|....  -..+++++|+++||||||||||+++++  .|++++||.|     +|.  .+|+++..|..+    
T Consensus       290 ~a~~~~~~~~~~~--~~~~~~~~~~~~A~hEaGhAlv~~~l~~~~~v~~vsi~p-----rg~--~~G~~~~~~~~~----  356 (495)
T TIGR01241       290 EAIDRVIAGPEKK--SRVISEKEKKLVAYHEAGHALVGLLLKDADPVHKVTIIP-----RGQ--ALGYTQFLPEED----  356 (495)
T ss_pred             HHHHHHhcccccc--cccccHHHHHHHHHHHHhHHHHHHhcCCCCceEEEEEee-----cCC--ccceEEecCccc----
Confidence            4688998887532  224679999999999999999999995  7999999999     674  556676666433    


Q ss_pred             ccCCCHHHHHHHHHHHchHHHHHHHHhCCC-cchHhHHHHHHHH----HHHhCCC-------------------------
Q 016447          284 EGRLSGTAFDRYSMVLFAGIAAEALIYGEA-EGGENDENLFRSI----CVLLQPP-------------------------  333 (389)
Q Consensus       284 ~g~lT~~~L~~~i~VlLAGrAAEeLvfGea-tGgsnDL~~ar~m----~~~lG~~-------------------------  333 (389)
                      .+..|+++++++++|+|||||||+++||+. +|+++|+++|+++    +..+|+.                         
T Consensus       357 ~~~~t~~~l~~~i~v~LaGraAE~~~~G~~s~Ga~~Dl~~At~lA~~mv~~~Gm~~~~g~~~~~~~~~~~~l~~~~~~~~  436 (495)
T TIGR01241       357 KYLYTKSQLLAQIAVLLGGRAAEEIIFGEVTTGASNDIKQATNIARAMVTEWGMSDKLGPVAYGSDGGDVFLGRGFAKAK  436 (495)
T ss_pred             cccCCHHHHHHHHHHHhhHHHHHHHHhcCCCCCchHHHHHHHHHHHHHHHHhCCCcccCceeeccCcccccccccccccc
Confidence            246799999999999999999999999986 5999999999755    3334420                         


Q ss_pred             -cc---H----HHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHhcCcHH
Q 016447          334 -LS---M----AQMSNQARWAVLQSYNLLKWHKHAHLEAVKALESGSSLS  375 (389)
Q Consensus       334 -~s---~----~~id~~vr~A~~rA~~LLrehr~aLe~LAeaLle~ETL~  375 (389)
                       ++   .    .++++.++++|.+|++||++|++++++||++|+++|+|+
T Consensus       437 ~~s~~~~~~id~~v~~lL~~a~~ra~~lL~~~~~~l~~la~~Ll~~e~L~  486 (495)
T TIGR01241       437 EYSEETAREIDEEVKRIIEEAYKRAKQILTENRDELELLAKALLEKETIT  486 (495)
T ss_pred             ccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHcCeeC
Confidence             11   1    223455679999999999999999999999999999984


No 7  
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]
Probab=99.88  E-value=1.2e-22  Score=218.23  Aligned_cols=163  Identities=20%  Similarity=0.259  Sum_probs=134.2

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecchhhhhcCccccccceecchhhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELA  283 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~  283 (389)
                      -++||++.|.+..  ...+++++++.+|||||||++++++++  +|+.++||+|      |.  +.|++++.|.++    
T Consensus       548 ~a~~Rvi~G~~~~--~~~~~~~~~~~~a~~eagha~~g~~l~~~dpl~kvsIiP------Gq--alG~a~~~P~~~----  613 (774)
T KOG0731|consen  548 YAIERVIAGMEKK--SRVLSLEEKKTVAYHEAGHAVVGWLLEHADPLLKVSIIP------GQ--ALGYAQYLPTDD----  613 (774)
T ss_pred             HHHHHHhcccccc--chhcCHhhhhhhhhhhccchhhhccccccCcceeEEecc------CC--ccceEEECCccc----
Confidence            3799999997642  235789999999999999999998887  7999999999      53  678888888644    


Q ss_pred             ccCCCHHHHHHHHHHHchHHHHHHHHhC-C-CcchHhHHHHHHHH----HHHhCC---------------------Cc--
Q 016447          284 EGRLSGTAFDRYSMVLFAGIAAEALIYG-E-AEGGENDENLFRSI----CVLLQP---------------------PL--  334 (389)
Q Consensus       284 ~g~lT~~~L~~~i~VlLAGrAAEeLvfG-e-atGgsnDL~~ar~m----~~~lG~---------------------~~--  334 (389)
                       +.+|+.+|.+++|++|||||||+++|| + ++|++||++++|.|    +..+|+                     ++  
T Consensus       614 -~l~sk~ql~~rm~m~LGGRaAEev~fg~~iTtga~ddl~kvT~~A~~~V~~~Gms~kig~~~~~~~~~~~~~~~~p~s~  692 (774)
T KOG0731|consen  614 -YLLSKEQLFDRMVMALGGRAAEEVVFGSEITTGAQDDLEKVTKIARAMVASFGMSEKIGPISFQMLLPGDESFRKPYSE  692 (774)
T ss_pred             -ccccHHHHHHHHHHHhCcchhhheecCCccCchhhccHHHHHHHHHHHHHHcCcccccCceeccCcccccccccCccch
Confidence             568999999999999999999999998 4 57999999998755    344442                     12  


Q ss_pred             -cHHHHHHHHH----HHHHHHHHHHHHcHHHHHHHHHHHHhcCcH--HHHHHHHHH
Q 016447          335 -SMAQMSNQAR----WAVLQSYNLLKWHKHAHLEAVKALESGSSL--SVVIRRIEE  383 (389)
Q Consensus       335 -s~~~id~~vr----~A~~rA~~LLrehr~aLe~LAeaLle~ETL--~~Ci~~IE~  383 (389)
                       +.+.||.+++    .||++|.++|++|++.++.+|+.|+++|++  ++++.++..
T Consensus       693 ~~~~~Id~ev~~lv~~ay~~~~~ll~~n~~~l~~ia~~LLeke~l~~ee~~~ll~~  748 (774)
T KOG0731|consen  693 KTAQLIDTEVRRLVQKAYERTKELLRTNRDKLDKIAEVLLEKEVLTGEEIIALLGE  748 (774)
T ss_pred             hHHHHHHHHHHHHHhhHHHHHHHHHHHhHHHHHHHHHHHHHhhhccHHHHHHHhcc
Confidence             2345776655    499999999999999999999999999997  777777654


No 8  
>CHL00206 ycf2 Ycf2; Provisional
Probab=98.79  E-value=7.3e-09  Score=120.76  Aligned_cols=108  Identities=18%  Similarity=0.141  Sum_probs=78.1

Q ss_pred             HHHHHHHhCcccccccCCCChhhhHHHHHHHHhHHHHHHHhC--CCcceEEecch-hhhhcCccccccceecchhhhhhh
Q 016447          206 ALVDAIFLGGVCLAQISSYWPPYKRRILVHEAGHLLIAYLMG--CPIRGVILDPI-VAMQMGIQGQAGTQFWDEKMNNEL  282 (389)
Q Consensus       206 ~aiD~V~~Gg~~~~~l~~ls~~ekrRIAyHEAGHALVAyLLg--~PV~kvTIiP~-~a~rrG~~gagGt~f~~p~~e~~l  282 (389)
                      .|+||+++|...  +.  .+..++ +|||||+|||+|+.++.  +||+++||.|- ...++|  .+.|++++.|..    
T Consensus      1872 ~Al~Rq~~g~~~--~~--~~~~~~-~ia~yEiGhAvvq~~L~~~~pv~kISIy~~~~~~r~~--~~yl~~wyle~~---- 1940 (2281)
T CHL00206       1872 SALHRQTWDLRS--QV--RSVQDH-GILFYQIGRAVAQNVLLSNCPIDPISIYMKKKSCKEG--DSYLYKWYFELG---- 1940 (2281)
T ss_pred             HHHHHHHhhhhh--cc--cCcchh-hhhhhHHhHHHHHHhccCCCCcceEEEecCCccccCc--ccceeEeecCCc----
Confidence            479999999752  22  233444 58999999999999986  79999999641 112222  345777777742    


Q ss_pred             hccCCCHHHHHHHHHHHchHHHHHHHHhCCC--------c-ch-HhHHHHHHHH
Q 016447          283 AEGRLSGTAFDRYSMVLFAGIAAEALIYGEA--------E-GG-ENDENLFRSI  326 (389)
Q Consensus       283 ~~g~lT~~~L~~~i~VlLAGrAAEeLvfGea--------t-Gg-snDL~~ar~m  326 (389)
                        ..+++.++..+++++|||+|||++.|+..        . |- .+|+..+-.+
T Consensus      1941 --~~mkk~tiL~~Il~cLAGraAedlwf~~~~~~~n~It~yg~vEnD~~La~gl 1992 (2281)
T CHL00206       1941 --TSMKKLTILLYLLSCSAGSVAQDLWSLPGPDEKNGITSYGLVENDSDLVHGL 1992 (2281)
T ss_pred             --ccCCHHHHHHHHHHHhhhhhhhhhccCcchhhhcCcccccchhhhhHHhHhH
Confidence              46799999999999999999999999632        1 32 5787766544


No 9  
>cd06163 S2P-M50_PDZ_RseP-like RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog RseP is involved in the sigmaE pathway of extracytoplasmic stress responses. Also included in this group are such homologs as Bacillus subtilis YluC, Mycobacterium tuberculosis Rv2869c S2P, and Bordetella bronchiseptica HurP.  Rv2869c S2P appears to have a role in the regulation of prokaryotic lipid biosynthesis and membrane composition and YluC of Bacillus has a role in transducing membrane stress. This group includes bacterial and eukaryotic S2P/M50s homologs with either one or two PDZ domains present. PDZ domains are believed to have a regulatory role. The RseP PDZ domain is required for the inhibitory reaction that prevents cleavage of its substrate, RseA.
Probab=96.99  E-value=0.0011  Score=61.62  Aligned_cols=24  Identities=42%  Similarity=0.697  Sum_probs=21.3

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEE
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVI  254 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvT  254 (389)
                      -|..||.||+++|...|.+|.+++
T Consensus        11 ~v~iHElGH~~~Ar~~Gv~v~~f~   34 (182)
T cd06163          11 LIFVHELGHFLVAKLFGVKVEEFS   34 (182)
T ss_pred             HHHHHHHHHHHHHHHcCCeeeEee
Confidence            378999999999999999998844


No 10 
>cd06164 S2P-M50_SpoIVFB_CBS SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. In this subgroup, SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain. SpoIVFB is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB. It has been proposed tha
Probab=96.54  E-value=0.0024  Score=61.07  Aligned_cols=60  Identities=23%  Similarity=0.321  Sum_probs=44.5

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEecchhhhhcCccccccceecchhhhhhhhccCCCHHHHHHHHHHHchHHHHHHHHh
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELAEGRLSGTAFDRYSMVLFAGIAAEALIY  310 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~~g~lT~~~L~~~i~VlLAGrAAEeLvf  310 (389)
                      -+..||.||+++|+.+|.+++++++.|+          ||++..+++.        .+   ..+.+.|++||-++.-++.
T Consensus        55 ~v~iHElgH~~~A~~~G~~v~~i~l~p~----------Gg~~~~~~~~--------~~---~~~~~~IalAGPl~Nllla  113 (227)
T cd06164          55 SVLLHELGHSLVARRYGIPVRSITLFLF----------GGVARLEREP--------ET---PGQEFVIAIAGPLVSLVLA  113 (227)
T ss_pred             HHHHHHHHHHHHHHHcCCeECeEEEEee----------eEEEEecCCC--------CC---HHHHhhhhhhHHHHHHHHH
Confidence            5789999999999999999999999993          3444443311        12   2345679999999987764


Q ss_pred             C
Q 016447          311 G  311 (389)
Q Consensus       311 G  311 (389)
                      .
T Consensus       114 ~  114 (227)
T cd06164         114 L  114 (227)
T ss_pred             H
Confidence            3


No 11 
>cd06161 S2P-M50_SpoIVFB SpoIVFB Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50B), regulates intramembrane proteolysis (RIP), and is involved in the pro-sigmaK pathway of bacterial spore formation. SpoIVFB (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) is one of 4 proteins involved in endospore formation; the others are SpoIVFA (sporulation protein, stage IV cell wall formation, F locus, promoter-proximal A), BofA (bypass-of-forespore A), and SpoIVB (sporulation protein, stage IV cell wall formation, B locus). SpoIVFB is negatively regulated by SpoIVFA and BofA and activated by SpoIVB. It is thought that SpoIVFB, SpoIVFA, and BofA are located in the mother-cell membrane that surrounds the forespore and that SpoIVB is secreted from the forespore into the space between the two where it activates SpoIVFB.
Probab=96.40  E-value=0.0027  Score=59.68  Aligned_cols=60  Identities=30%  Similarity=0.475  Sum_probs=43.3

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEecchhhhhcCccccccceecchhhhhhhhccCCCHHHHHHHHHHHchHHHHHHHHh
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELAEGRLSGTAFDRYSMVLFAGIAAEALIY  310 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~~g~lT~~~L~~~i~VlLAGrAAEeLvf  310 (389)
                      -+..||.||+++|+.+|.+++++++.|+     |     |....++.       .  .  .-.+.+.|++||-.+.-++.
T Consensus        40 ~v~iHElgH~~~A~~~G~~v~~i~l~p~-----G-----g~~~~~~~-------~--~--~~~~~~lIalAGPl~n~~la   98 (208)
T cd06161          40 SVLLHELGHALVARRYGIRVRSITLLPF-----G-----GVAELEEE-------P--E--TPKEEFVIALAGPLVSLLLA   98 (208)
T ss_pred             HHHHHHHHHHHHHHHcCCCccceEEEee-----e-----eeeeeccC-------C--C--ChhHheeeeeehHHHHHHHH
Confidence            5789999999999999999999999993     2     32222211       0  1  22345678999999997765


Q ss_pred             C
Q 016447          311 G  311 (389)
Q Consensus       311 G  311 (389)
                      .
T Consensus        99 ~   99 (208)
T cd06161          99 G   99 (208)
T ss_pred             H
Confidence            4


No 12 
>PRK10779 zinc metallopeptidase RseP; Provisional
Probab=96.19  E-value=0.0046  Score=64.25  Aligned_cols=26  Identities=31%  Similarity=0.451  Sum_probs=23.4

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEec
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILD  256 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIi  256 (389)
                      .|.+||.||||+|.++|..|.+++|-
T Consensus        17 li~vHElGHfl~Ar~~gv~V~~FsiG   42 (449)
T PRK10779         17 LITVHEFGHFWVARRCGVRVERFSIG   42 (449)
T ss_pred             HHHHHHHHHHHHHHHcCCeeeEEEee
Confidence            58899999999999999999987764


No 13 
>cd05709 S2P-M50 Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. The domain core structure appears to contain at least three transmembrane helices with a catalytic zinc atom coordinated by three conserved residues contained within the consensus sequence HExxH, together with a conserved aspartate residue. The S2P/M50 family of RIP proteases is widely distributed; in eukaryotic cells, they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum (ER) stress responses. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of sterol regulatory element-bindin
Probab=96.17  E-value=0.0032  Score=56.93  Aligned_cols=75  Identities=21%  Similarity=0.106  Sum_probs=42.0

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEecchhhhhc-----Cc--cccccceecchhhhhhhhccCCCHHHHHHHHHHHchHH
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILDPIVAMQM-----GI--QGQAGTQFWDEKMNNELAEGRLSGTAFDRYSMVLFAGI  303 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIiP~~a~rr-----G~--~gagGt~f~~p~~e~~l~~g~lT~~~L~~~i~VlLAGr  303 (389)
                      -+..||.||+++|+..|+++.+.++...-...+     |.  ---+|+....+..++.      .+..-.+.+.|.+||.
T Consensus        10 ~i~iHE~gH~~~A~~~G~~~~~~~~~~~~~~~~~~~~~~~~~ip~gG~~~~~~~~~~~------~~~~~~~~~~i~laGP   83 (180)
T cd05709          10 SVTVHELGHALVARRLGVKVARFSGGFTLNPLKHGDPYGIILIPLGGYAKPVGENPRA------FKKPRWQRLLVALAGP   83 (180)
T ss_pred             HHHHHHHHHHHHHHHcCCCchheeeeEEECCcCCCCEehHHHHhccCeeccCCCChhh------hccchhhhhhhhhhhH
Confidence            368999999999999999776554321000000     00  0023444333321110      0123445667899999


Q ss_pred             HHHHHHhC
Q 016447          304 AAEALIYG  311 (389)
Q Consensus       304 AAEeLvfG  311 (389)
                      .+.-+...
T Consensus        84 l~nllla~   91 (180)
T cd05709          84 LANLLLAL   91 (180)
T ss_pred             HHHHHHHH
Confidence            99987654


No 14 
>PF13398 Peptidase_M50B:  Peptidase M50B-like
Probab=96.08  E-value=0.0059  Score=57.19  Aligned_cols=27  Identities=44%  Similarity=0.753  Sum_probs=25.8

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEecc
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILDP  257 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIiP  257 (389)
                      -+..||.||++++.++|..++++++.|
T Consensus        24 ~t~~HE~gHal~a~l~G~~v~~i~l~~   50 (200)
T PF13398_consen   24 VTFVHELGHALAALLTGGRVKGIVLFP   50 (200)
T ss_pred             HHHHHHHHHHHHHHHhCCCcceEEEEe
Confidence            389999999999999999999999999


No 15 
>TIGR00054 RIP metalloprotease RseP. A model that detects fragments as well matches a number of members of the PEPTIDASE FAMILY S2C. The region of match appears not to overlap the active site domain.
Probab=95.93  E-value=0.0067  Score=62.66  Aligned_cols=22  Identities=45%  Similarity=0.674  Sum_probs=20.1

Q ss_pred             HHHHHHHhHHHHHHHhCCCcce
Q 016447          231 RILVHEAGHLLIAYLMGCPIRG  252 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~k  252 (389)
                      .|.+||.||+++|.++|..|.+
T Consensus        16 ~v~~HE~gH~~~a~~~g~~v~~   37 (420)
T TIGR00054        16 LIFVHELGHFLAARLCGIKVER   37 (420)
T ss_pred             HHHHHhHHHHHHHHHcCCEEEE
Confidence            5789999999999999998885


No 16 
>PF02163 Peptidase_M50:  Peptidase family M50;  InterPro: IPR008915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry contains metallopeptidases belonging to MEROPS peptidase family M50 (S2P protease family, clan MM).  Members of the M50 metallopeptidase family include: mammalian sterol-regulatory element binding protein (SREBP) site 2 protease, Escherichia coli protease EcfE, stage IV sporulation protein FB and various hypothetical bacterial and eukaryotic homologues. A number of proteins are classified as non-peptidase homologues as they either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity.; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3B4R_A 3ID4_A 3ID2_A 2ZPL_B 3ID1_A 2ZPM_A 3ID3_B 2HGA_A.
Probab=95.74  E-value=0.0092  Score=54.23  Aligned_cols=24  Identities=38%  Similarity=0.445  Sum_probs=18.0

Q ss_pred             HHHHHHhHHHHHHHhCCCcceEEe
Q 016447          232 ILVHEAGHLLIAYLMGCPIRGVIL  255 (389)
Q Consensus       232 IAyHEAGHALVAyLLg~PV~kvTI  255 (389)
                      +..||.||+++|+..|+++.++++
T Consensus        10 i~~HE~gH~~~a~~~G~~~~~~~~   33 (192)
T PF02163_consen   10 IVLHELGHALAARLYGDKVPRFEG   33 (192)
T ss_dssp             HHHHHHHHHHHHHTTT--B--EEE
T ss_pred             cccccccccccccccccccccccc
Confidence            678999999999999999888853


No 17 
>cd06162 S2P-M50_PDZ_SREBP Sterol regulatory element-binding protein (SREBP) Site-2 protease (S2P), a zinc metalloprotease (MEROPS family M50A), regulates intramembrane proteolysis (RIP) of SREBP and is part of a signal transduction mechanism involved in sterol and lipid metabolism. In sterol-depleted mammalian cells, a two-step proteolytic process releases the N-terminal domains of SREBPs from membranes of the endoplasmic reticulum (ER). These domains translocate into the nucleus, where they activate genes of cholesterol and fatty acid biosynthesis. The first cleavage occurs at Site-1 within the ER lumen to generate an intermediate that is subsequently released from the membrane by cleavage at Site-2, which lies within the first transmembrane domain. It is the second proteolytic step that is carried out by the SREBP Site-2 protease (S2P) which is present in this CD family.  This group appears to be limited to eumetazoan proteins and contains one PDZ domain.
Probab=94.94  E-value=0.025  Score=56.15  Aligned_cols=67  Identities=15%  Similarity=0.024  Sum_probs=43.8

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEecchhhhhcCccccccceecchhhhhhhhccCCCHHHHHHHHHHHchHHHHHHHHh
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELAEGRLSGTAFDRYSMVLFAGIAAEALIY  310 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~~g~lT~~~L~~~i~VlLAGrAAEeLvf  310 (389)
                      -+..||-||+++|...|.+|+++.+.++--+      -+|+.-.+++  +. .  ..+.   .+++.|++||.++.-++-
T Consensus       137 svvvHElgHal~A~~~gi~V~~iGl~l~~~~------pGa~ve~~~e--~~-~--~~~~---~~~l~Ia~AGp~~NlvLa  202 (277)
T cd06162         137 SGVVHEMGHGVAAVREQVRVNGFGIFFFIIY------PGAYVDLFTD--HL-N--LISP---VQQLRIFCAGVWHNFVLG  202 (277)
T ss_pred             HHHHHHHHHHHHHHHcCCeeceEEEeeeecc------CeeEEeeccc--cc-c--cCCh---hhhhheehhhHHHHHHHH
Confidence            4689999999999999999999988763111      1333333222  11 1  1222   246689999999988765


Q ss_pred             C
Q 016447          311 G  311 (389)
Q Consensus       311 G  311 (389)
                      .
T Consensus       203 ~  203 (277)
T cd06162         203 L  203 (277)
T ss_pred             H
Confidence            4


No 18 
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=94.22  E-value=0.038  Score=51.47  Aligned_cols=27  Identities=30%  Similarity=0.308  Sum_probs=25.2

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEecc
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILDP  257 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIiP  257 (389)
                      -+..||.||+++|+..|+++.+..+.|
T Consensus        43 ~l~iHElgH~~~A~~~G~~~~~~~l~P   69 (183)
T cd06160          43 ILGIHEMGHYLAARRHGVKASLPYFIP   69 (183)
T ss_pred             HHHHHHHHHHHHHHHCCCCccceeeee
Confidence            578999999999999999999999888


No 19 
>cd06159 S2P-M50_PDZ_Arch Uncharacterized Archaeal homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group appears to be limited to Archaeal S2P/M50s homologs with additional putative N-terminal transmembrane spanning regions, relative to the core protein, and either one or two PDZ domains present.
Probab=92.31  E-value=0.056  Score=53.16  Aligned_cols=66  Identities=18%  Similarity=0.194  Sum_probs=40.3

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEecchhhhhcCccccccceecchhhhhhhhccCCCHHHHHHHHHHHchHHHHHHHHh
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILDPIVAMQMGIQGQAGTQFWDEKMNNELAEGRLSGTAFDRYSMVLFAGIAAEALIY  310 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIiP~~a~rrG~~gagGt~f~~p~~e~~l~~g~lT~~~L~~~i~VlLAGrAAEeLvf  310 (389)
                      -+..||.||+++|...|++|+.+.+.-     ... --||  +..|+++..      .+..-.+++.|++||..+.-+..
T Consensus       120 sv~iHElgHa~~Ar~~G~~V~~iGl~l-----~~i-p~Gg--~v~~~~~~~------~~~~~~~~~~Ia~AGP~~Nlvla  185 (263)
T cd06159         120 GVVVHELSHGILARVEGIKVKSGGLLL-----LII-PPGA--FVEPDEEEL------NKADRRIRLRIFAAGVTANFVVA  185 (263)
T ss_pred             HHHHHHHHHHHHHHHcCCEECchhHHH-----Hhh-hcEE--EEEecchhh------ccCChhheeeeeeehHHHHHHHH
Confidence            478999999999999999988865421     000 0123  333322211      11223356678999998886654


No 20 
>cd06158 S2P-M50_like_1 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with a minimal core protein and no PDZ domains.
Probab=89.39  E-value=0.26  Score=45.61  Aligned_cols=75  Identities=21%  Similarity=0.248  Sum_probs=41.1

Q ss_pred             HHHHHHhHHHHHHHhCCCcc----eEEecchhhhhc-Ccc----c-cccceecchhhhhhhhccCCCHHHHHHHHHHHch
Q 016447          232 ILVHEAGHLLIAYLMGCPIR----GVILDPIVAMQM-GIQ----G-QAGTQFWDEKMNNELAEGRLSGTAFDRYSMVLFA  301 (389)
Q Consensus       232 IAyHEAGHALVAyLLg~PV~----kvTIiP~~a~rr-G~~----g-agGt~f~~p~~e~~l~~g~lT~~~L~~~i~VlLA  301 (389)
                      +..||.||+++|+..|++..    ..|+.|+.-..- |.-    . ..|..+..|..-+.   ... ++.-.+...|++|
T Consensus        12 i~~HE~aHa~~A~~~Gd~t~~~~Grltlnp~~hid~~g~l~~~~~~~~~~G~a~p~~~~~---~~~-~~~r~~~~~valA   87 (181)
T cd06158          12 ITLHEFAHAYVAYRLGDPTARRAGRLTLNPLAHIDPIGTIILPLLLPFLFGWAKPVPVNP---RNF-KNPRRGMLLVSLA   87 (181)
T ss_pred             HHHHHHHHHHHHHHcCCcHHHHcCceecCcHHhcCcchHHHHHHHHHhCeEEecccccCh---Hhh-cccHhhHhhhhhh
Confidence            67899999999999998665    367767311110 100    0 00233333321111   011 2222345679999


Q ss_pred             HHHHHHHHh
Q 016447          302 GIAAEALIY  310 (389)
Q Consensus       302 GrAAEeLvf  310 (389)
                      |-++.-+..
T Consensus        88 GP~~n~~la   96 (181)
T cd06158          88 GPLSNLLLA   96 (181)
T ss_pred             hHHHHHHHH
Confidence            999987653


No 21 
>PF14247 DUF4344:  Domain of unknown function (DUF4344)
Probab=83.16  E-value=0.84  Score=44.05  Aligned_cols=19  Identities=47%  Similarity=0.651  Sum_probs=15.1

Q ss_pred             HHHHHHHhHHHHHHHhCCCc
Q 016447          231 RILVHEAGHLLIAYLMGCPI  250 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV  250 (389)
                      -|-|||.||||+..+ +.||
T Consensus        94 ~~l~HE~GHAlI~~~-~lPv  112 (220)
T PF14247_consen   94 FTLYHELGHALIDDL-DLPV  112 (220)
T ss_pred             HHHHHHHHHHHHHHh-cCCc
Confidence            588999999999854 4554


No 22 
>PF00413 Peptidase_M10:  Matrixin This Prosite motif covers only the active site.;  InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)).  The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=80.52  E-value=0.81  Score=39.62  Aligned_cols=16  Identities=31%  Similarity=0.482  Sum_probs=13.5

Q ss_pred             hhhhHHHHHHHHhHHH
Q 016447          226 PPYKRRILVHEAGHLL  241 (389)
Q Consensus       226 ~~ekrRIAyHEAGHAL  241 (389)
                      ..+...|+.||.||+|
T Consensus       102 ~~~~~~v~~HEiGHaL  117 (154)
T PF00413_consen  102 GNDLQSVAIHEIGHAL  117 (154)
T ss_dssp             SEEHHHHHHHHHHHHT
T ss_pred             hhhhhhhhhhcccccc
Confidence            4567799999999985


No 23 
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=77.30  E-value=1.4  Score=38.88  Aligned_cols=17  Identities=35%  Similarity=0.415  Sum_probs=14.1

Q ss_pred             hhhhHHHHHHHHhHHHH
Q 016447          226 PPYKRRILVHEAGHLLI  242 (389)
Q Consensus       226 ~~ekrRIAyHEAGHALV  242 (389)
                      ..+...|+.||.||+|=
T Consensus       101 ~~~~~~~~~HEiGHaLG  117 (156)
T cd04279         101 AENLQAIALHELGHALG  117 (156)
T ss_pred             chHHHHHHHHHhhhhhc
Confidence            45778999999999863


No 24 
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=73.64  E-value=2.1  Score=37.54  Aligned_cols=16  Identities=38%  Similarity=0.416  Sum_probs=13.6

Q ss_pred             hhhhHHHHHHHHhHHH
Q 016447          226 PPYKRRILVHEAGHLL  241 (389)
Q Consensus       226 ~~ekrRIAyHEAGHAL  241 (389)
                      ..+...++.||.||+|
T Consensus        91 ~~~~~~~~~HEiGHaL  106 (165)
T cd04268          91 GARLRNTAEHELGHAL  106 (165)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            3567899999999996


No 25 
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=69.06  E-value=2.2  Score=37.79  Aligned_cols=16  Identities=31%  Similarity=0.343  Sum_probs=13.5

Q ss_pred             hhhhHHHHHHHHhHHH
Q 016447          226 PPYKRRILVHEAGHLL  241 (389)
Q Consensus       226 ~~ekrRIAyHEAGHAL  241 (389)
                      ..+...|+.||.||+|
T Consensus       104 ~~~~~~~~~HEiGHaL  119 (157)
T cd04278         104 GTDLFSVAAHEIGHAL  119 (157)
T ss_pred             cchHHHHHHHHhcccc
Confidence            4567899999999984


No 26 
>PF02031 Peptidase_M7:  Streptomyces extracellular neutral proteinase (M7) family;  InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=67.23  E-value=3.7  Score=36.92  Aligned_cols=15  Identities=47%  Similarity=0.685  Sum_probs=11.6

Q ss_pred             hhhHHHHHHHHhHHH
Q 016447          227 PYKRRILVHEAGHLL  241 (389)
Q Consensus       227 ~ekrRIAyHEAGHAL  241 (389)
                      -+.-||+-||.||.|
T Consensus        75 y~~~RIaaHE~GHiL   89 (132)
T PF02031_consen   75 YNSTRIAAHELGHIL   89 (132)
T ss_dssp             S-HHHHHHHHHHHHH
T ss_pred             Cccceeeeehhcccc
Confidence            345689999999975


No 27 
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=64.96  E-value=4.1  Score=37.05  Aligned_cols=17  Identities=35%  Similarity=0.593  Sum_probs=14.1

Q ss_pred             hhhhHHHHHHHHhHHHH
Q 016447          226 PPYKRRILVHEAGHLLI  242 (389)
Q Consensus       226 ~~ekrRIAyHEAGHALV  242 (389)
                      ..+...++.||.||+|=
T Consensus       110 g~~~~~t~~HEiGHaLG  126 (186)
T cd04277         110 GSYGYQTIIHEIGHALG  126 (186)
T ss_pred             ChhhHHHHHHHHHHHhc
Confidence            35678999999999873


No 28 
>PF04298 Zn_peptidase_2:  Putative neutral zinc metallopeptidase;  InterPro: IPR007395 Members of this family of bacterial proteins are described as hypothetical proteins or zinc-dependent proteases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=61.49  E-value=4.2  Score=39.52  Aligned_cols=13  Identities=31%  Similarity=0.580  Sum_probs=10.7

Q ss_pred             HHHHHHHhHHHHH
Q 016447          231 RILVHEAGHLLIA  243 (389)
Q Consensus       231 RIAyHEAGHALVA  243 (389)
                      -||-||+|||+=-
T Consensus        91 aVAAHEvGHAiQ~  103 (222)
T PF04298_consen   91 AVAAHEVGHAIQH  103 (222)
T ss_pred             HHHHHHHhHHHhc
Confidence            4899999999743


No 29 
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane]
Probab=60.78  E-value=6.6  Score=39.18  Aligned_cols=26  Identities=27%  Similarity=0.499  Sum_probs=22.3

Q ss_pred             HHHHHHHhHHHHHHHhCCCcceEEec
Q 016447          231 RILVHEAGHLLIAYLMGCPIRGVILD  256 (389)
Q Consensus       231 RIAyHEAGHALVAyLLg~PV~kvTIi  256 (389)
                      .+..||-||+++++.++..|.+++|.
T Consensus        15 lv~~he~gh~~~a~~~~~~v~~f~ig   40 (375)
T COG0750          15 LVFVHELGHFWVARRCGVKVERFSIG   40 (375)
T ss_pred             HHHHHHHhhHHHHHhcCceeEEEEec
Confidence            58899999999999999877777653


No 30 
>KOG2921 consensus Intramembrane metalloprotease (sterol-regulatory element-binding protein (SREBP) protease) [Posttranslational modification, protein turnover, chaperones]
Probab=59.80  E-value=7  Score=41.22  Aligned_cols=25  Identities=36%  Similarity=0.503  Sum_probs=21.2

Q ss_pred             HHHHHHhHHHHHHHhCCCcceEEec
Q 016447          232 ILVHEAGHLLIAYLMGCPIRGVILD  256 (389)
Q Consensus       232 IAyHEAGHALVAyLLg~PV~kvTIi  256 (389)
                      .-+||.||||+|-.-|.+|.++-|-
T Consensus       134 ~vvHElGHalAA~segV~vngfgIf  158 (484)
T KOG2921|consen  134 VVVHELGHALAAASEGVQVNGFGIF  158 (484)
T ss_pred             HHHHHhhHHHHHHhcCceeeeeEEE
Confidence            4689999999999999888877543


No 31 
>cd04327 ZnMc_MMP_like_3 Zinc-dependent metalloprotease; MMP_like sub-family 3. A group of bacterial and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=58.27  E-value=6.3  Score=36.59  Aligned_cols=17  Identities=35%  Similarity=0.401  Sum_probs=13.3

Q ss_pred             hhHHHHHHHHhHHHHHH
Q 016447          228 YKRRILVHEAGHLLIAY  244 (389)
Q Consensus       228 ekrRIAyHEAGHALVAy  244 (389)
                      +...++.||.||||=-+
T Consensus        91 ~~~~~i~HElgHaLG~~  107 (198)
T cd04327          91 EFSRVVLHEFGHALGFI  107 (198)
T ss_pred             hHHHHHHHHHHHHhcCc
Confidence            45679999999997543


No 32 
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=56.74  E-value=5.5  Score=34.34  Aligned_cols=11  Identities=45%  Similarity=0.752  Sum_probs=9.9

Q ss_pred             HHHHHHHhHHH
Q 016447          231 RILVHEAGHLL  241 (389)
Q Consensus       231 RIAyHEAGHAL  241 (389)
                      .|+.||.||+|
T Consensus        88 ~~~~HEigHaL   98 (140)
T smart00235       88 GVAAHELGHAL   98 (140)
T ss_pred             ccHHHHHHHHh
Confidence            39999999997


No 33 
>PF05572 Peptidase_M43:  Pregnancy-associated plasma protein-A;  InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=51.18  E-value=6.8  Score=35.52  Aligned_cols=16  Identities=38%  Similarity=0.474  Sum_probs=12.9

Q ss_pred             hhhhHHHHHHHHhHHH
Q 016447          226 PPYKRRILVHEAGHLL  241 (389)
Q Consensus       226 ~~ekrRIAyHEAGHAL  241 (389)
                      +....++..||.||.|
T Consensus        66 ~~~~g~TltHEvGH~L   81 (154)
T PF05572_consen   66 QYNFGKTLTHEVGHWL   81 (154)
T ss_dssp             TS-SSHHHHHHHHHHT
T ss_pred             ccccccchhhhhhhhh
Confidence            4566799999999987


No 34 
>PF13812 PPR_3:  Pentatricopeptide repeat domain
Probab=49.67  E-value=24  Score=22.33  Aligned_cols=28  Identities=21%  Similarity=0.476  Sum_probs=25.2

Q ss_pred             HHHhhhccchHHHHHHHHHHHHhCCCCC
Q 016447          104 VLDTCLNADDLKLVASAYKFLQNRGFLP  131 (389)
Q Consensus       104 ~l~~~~~~~d~~~v~~~y~~l~~~G~l~  131 (389)
                      ++++|.+..|.+.+-++++.+++.|.-|
T Consensus         7 ll~a~~~~g~~~~a~~~~~~M~~~gv~P   34 (34)
T PF13812_consen    7 LLRACAKAGDPDAALQLFDEMKEQGVKP   34 (34)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhCCCC
Confidence            6899999999999999999999998644


No 35 
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=46.38  E-value=10  Score=33.05  Aligned_cols=16  Identities=31%  Similarity=0.378  Sum_probs=13.2

Q ss_pred             hhhHHHHHHHHhHHHH
Q 016447          227 PYKRRILVHEAGHLLI  242 (389)
Q Consensus       227 ~ekrRIAyHEAGHALV  242 (389)
                      ..-..++.||.||+|=
T Consensus        94 ~~~~~~~~HElGH~LG  109 (167)
T cd00203          94 KEGAQTIAHELGHALG  109 (167)
T ss_pred             ccchhhHHHHHHHHhC
Confidence            3567899999999985


No 36 
>PF06114 DUF955:  Domain of unknown function (DUF955);  InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=44.65  E-value=22  Score=28.53  Aligned_cols=23  Identities=35%  Similarity=0.417  Sum_probs=17.5

Q ss_pred             CChhhhHHHHHHHHhHHHHHHHh
Q 016447          224 YWPPYKRRILVHEAGHLLIAYLM  246 (389)
Q Consensus       224 ls~~ekrRIAyHEAGHALVAyLL  246 (389)
                      .++..++=+..||.||.+...--
T Consensus        37 ~~~~~~~f~laHELgH~~~~~~~   59 (122)
T PF06114_consen   37 LSPERQRFTLAHELGHILLHHGD   59 (122)
T ss_dssp             S-HHHHHHHHHHHHHHHHHHH-H
T ss_pred             CCHHHHHHHHHHHHHHHHhhhcc
Confidence            56777778999999999987543


No 37 
>PF07035 Mic1:  Colon cancer-associated protein Mic1-like;  InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1.
Probab=41.36  E-value=97  Score=28.81  Aligned_cols=63  Identities=22%  Similarity=0.512  Sum_probs=47.4

Q ss_pred             HHHHHHH-HHHHHH----hhhcHHHHHHHhhh-cCCCCCCCccchhhhhcccccccCCccCCCCchhHHHHhhhccchHH
Q 016447           42 RALKEWQ-EYEDAV----KRKDLARALRFLKN-KNDNNPIEPLSDSLMGESNRARLPEFVGGFDRDWEVLDTCLNADDLK  115 (389)
Q Consensus        42 ~~~~~~~-~~~~~~----~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~d~~  115 (389)
                      .-|+.-+ .||.-|    ..+++..|+||.++ +..+.            +     |.        =.+|+++.+.+|..
T Consensus        83 DMLkRL~~~~~~iievLL~~g~vl~ALr~ar~~~~~~~------------~-----~~--------~~fLeAA~~~~D~~  137 (167)
T PF07035_consen   83 DMLKRLGTAYEEIIEVLLSKGQVLEALRYARQYHKVDS------------V-----PA--------RKFLEAAANSNDDQ  137 (167)
T ss_pred             HHHHHhhhhHHHHHHHHHhCCCHHHHHHHHHHcCCccc------------C-----CH--------HHHHHHHHHcCCHH
Confidence            5566666 666655    58999999999987 33331            1     11        24799999999999


Q ss_pred             HHHHHHHHHHhCCC
Q 016447          116 LVASAYKFLQNRGF  129 (389)
Q Consensus       116 ~v~~~y~~l~~~G~  129 (389)
                      +...+|.+...++.
T Consensus       138 lf~~V~~ff~~~n~  151 (167)
T PF07035_consen  138 LFYAVFRFFEERNL  151 (167)
T ss_pred             HHHHHHHHHHHhhH
Confidence            99999999999883


No 38 
>PF13582 Reprolysin_3:  Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=35.00  E-value=19  Score=30.12  Aligned_cols=12  Identities=42%  Similarity=0.600  Sum_probs=10.4

Q ss_pred             HHHHHHHHhHHH
Q 016447          230 RRILVHEAGHLL  241 (389)
Q Consensus       230 rRIAyHEAGHAL  241 (389)
                      ..+..||.||.|
T Consensus       108 ~~~~~HEiGH~l  119 (124)
T PF13582_consen  108 VDTFAHEIGHNL  119 (124)
T ss_dssp             TTHHHHHHHHHT
T ss_pred             ceEeeehhhHhc
Confidence            389999999986


No 39 
>smart00762 Cog4 COG4 transport protein. This region is found in yeast oligomeric golgi complex component 4 which is involved in ER to Golgi and intra Golgi transport.
Probab=33.70  E-value=32  Score=34.70  Aligned_cols=21  Identities=33%  Similarity=0.645  Sum_probs=19.4

Q ss_pred             HHHHHHHHhhhcHHHHHHHhh
Q 016447           47 WQEYEDAVKRKDLARALRFLK   67 (389)
Q Consensus        47 ~~~~~~~~~~~~~~~~~~~~~   67 (389)
                      +++|++||+.+|.+...||.|
T Consensus        13 ~~~F~~Av~~~D~~~i~rffk   33 (324)
T smart00762       13 KERFDEAVKAQDVPELTRFFK   33 (324)
T ss_pred             HHHHHHHHHcCCHHHHHHHHH
Confidence            579999999999999999876


No 40 
>PF13485 Peptidase_MA_2:  Peptidase MA superfamily
Probab=33.34  E-value=43  Score=27.04  Aligned_cols=23  Identities=26%  Similarity=0.409  Sum_probs=18.4

Q ss_pred             ChhhhHHHHHHHHhHHHHHHHhC
Q 016447          225 WPPYKRRILVHEAGHLLIAYLMG  247 (389)
Q Consensus       225 s~~ekrRIAyHEAGHALVAyLLg  247 (389)
                      ++..-.++..||.+|.+.....+
T Consensus        21 ~~~~~~~~l~HE~~H~~~~~~~~   43 (128)
T PF13485_consen   21 DEDWLDRVLAHELAHQWFGNYFG   43 (128)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHcC
Confidence            34445699999999999988765


No 41 
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif). This family has a similar consensus to the TPR domain (tetratricopeptide), pfam pfam00515, a 33-residue repeat. It is predicted to form a pair of antiparallel helices similar to that of TPR.
Probab=29.69  E-value=89  Score=19.24  Aligned_cols=29  Identities=21%  Similarity=0.351  Sum_probs=25.7

Q ss_pred             HHHhhhccchHHHHHHHHHHHHhCCCCCC
Q 016447          104 VLDTCLNADDLKLVASAYKFLQNRGFLPS  132 (389)
Q Consensus       104 ~l~~~~~~~d~~~v~~~y~~l~~~G~l~~  132 (389)
                      +++++....+....-+.|..+++.|.-|+
T Consensus         6 li~~~~~~~~~~~a~~~~~~M~~~g~~p~   34 (35)
T TIGR00756         6 LIDGLCKAGRVEEALELFKEMLERGIEPD   34 (35)
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHcCCCCC
Confidence            67889999999999999999999998664


No 42 
>PF07998 Peptidase_M54:  Peptidase family M54;  InterPro: IPR012962 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This entry represents zinc-dependent peptidases belonging to the MEROPS peptidase family M54, more commonly known as the archaemetzincins. The family has a wide taxonomic distribution, being found in archaea, bacteria and eukaryotes. Two human homologues have been characterised []. ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 3LMC_A 2XHQ_A 2X7M_A.
Probab=27.94  E-value=30  Score=32.97  Aligned_cols=11  Identities=55%  Similarity=0.884  Sum_probs=9.3

Q ss_pred             HHHHHHHhHHH
Q 016447          231 RILVHEAGHLL  241 (389)
Q Consensus       231 RIAyHEAGHAL  241 (389)
                      +.+.||.||.+
T Consensus       147 Kea~HElGH~~  157 (194)
T PF07998_consen  147 KEAVHELGHLF  157 (194)
T ss_dssp             HHHHHHHHHHT
T ss_pred             HHHHHHHHHHc
Confidence            57999999965


No 43 
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases.  The M3 family is subdivided into two subfamilies: the widespread M3A, which comprises a number of high-molecular mass endo- and exopeptidases from bacteria, archaea, protozoa, fungi, plants and animals, and the small M3B, whose members are enzymes primarily from bacteria. Well-known mammalian/eukaryotic M3A endopeptidases are the thimet oligopeptidase (TOP; endopeptidase 3.4.24.15), neurolysin (alias endopeptidase 3.4.24.16), and the mitochondrial intermediate peptidase. The first two are intracellular oligopeptidases, which act only on relatively short substrates of less than 20 amino acid residues, while the latter cleaves N-terminal octapeptides from proteins during their import into the mitochondria. The M3A subfamily also contains several bacterial endopeptidases, collectively called olig
Probab=27.70  E-value=33  Score=34.26  Aligned_cols=22  Identities=27%  Similarity=0.261  Sum_probs=17.0

Q ss_pred             hhhHHHHHHHHhHHHHHHHhCC
Q 016447          227 PYKRRILVHEAGHLLIAYLMGC  248 (389)
Q Consensus       227 ~ekrRIAyHEAGHALVAyLLg~  248 (389)
                      -+-=.+..||.||++=..+...
T Consensus       152 ~~~v~tl~HE~GHa~h~~l~~~  173 (365)
T cd06258         152 HDDINTLFHEFGHAVHFLLIQQ  173 (365)
T ss_pred             HHHHHHHHHHHhHHHHHHHhcC
Confidence            3344789999999998887763


No 44 
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=26.77  E-value=32  Score=31.60  Aligned_cols=14  Identities=36%  Similarity=0.223  Sum_probs=11.7

Q ss_pred             HHHHHHHHhHHHHH
Q 016447          230 RRILVHEAGHLLIA  243 (389)
Q Consensus       230 rRIAyHEAGHALVA  243 (389)
                      ..++.||.||||=-
T Consensus        75 ~g~v~HE~~HalG~   88 (180)
T cd04280          75 LGTIVHELMHALGF   88 (180)
T ss_pred             CchhHHHHHHHhcC
Confidence            58999999999644


No 45 
>PF01400 Astacin:  Astacin (Peptidase family M12A) This Prosite motif covers only the active site.;  InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=26.61  E-value=41  Score=31.19  Aligned_cols=16  Identities=31%  Similarity=0.463  Sum_probs=12.1

Q ss_pred             hHHHHHHHHhHHHHHH
Q 016447          229 KRRILVHEAGHLLIAY  244 (389)
Q Consensus       229 krRIAyHEAGHALVAy  244 (389)
                      ...++.||.||||=-+
T Consensus        79 ~~~~i~HEl~HaLG~~   94 (191)
T PF01400_consen   79 SVGTILHELGHALGFW   94 (191)
T ss_dssp             SHHHHHHHHHHHHTB-
T ss_pred             CccchHHHHHHHHhhh
Confidence            3579999999997433


No 46 
>PF12388 Peptidase_M57:  Dual-action HEIGH metallo-peptidase;  InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=25.97  E-value=46  Score=32.24  Aligned_cols=20  Identities=25%  Similarity=0.358  Sum_probs=15.8

Q ss_pred             CChhhhHHHHHHHHhHHHHH
Q 016447          224 YWPPYKRRILVHEAGHLLIA  243 (389)
Q Consensus       224 ls~~ekrRIAyHEAGHALVA  243 (389)
                      .+....+.|..||.||.+==
T Consensus       128 ~~~~~~~hvi~HEiGH~IGf  147 (211)
T PF12388_consen  128 YSVNVIEHVITHEIGHCIGF  147 (211)
T ss_pred             CchhHHHHHHHHHhhhhccc
Confidence            35567888999999998743


No 47 
>PF12994 DUF3878:  Domain of unknown function, E. rectale Gene description (DUF3878);  InterPro: IPR024538 This entry represents proteins of unknown function found primarily in Firmicutes. The Eubacterium rectale gene appears to be upregulated in the presence of Bacteroides thetaiotaomicron compared to growth in pure culture []. 
Probab=25.92  E-value=14  Score=37.49  Aligned_cols=17  Identities=18%  Similarity=0.169  Sum_probs=13.8

Q ss_pred             hhhHHHHHHHHhHHHHH
Q 016447          227 PYKRRILVHEAGHLLIA  243 (389)
Q Consensus       227 ~ekrRIAyHEAGHALVA  243 (389)
                      .+..---|||.|||||-
T Consensus        92 ~~~~lY~Y~~iGHFWVk  108 (299)
T PF12994_consen   92 EETHLYNYGEIGHFWVK  108 (299)
T ss_pred             HHHHHhhccccceeeec
Confidence            55666789999999984


No 48 
>COG2738 Predicted Zn-dependent protease [General function prediction only]
Probab=24.07  E-value=40  Score=32.72  Aligned_cols=13  Identities=31%  Similarity=0.593  Sum_probs=10.8

Q ss_pred             HHHHHHHhHHHHH
Q 016447          231 RILVHEAGHLLIA  243 (389)
Q Consensus       231 RIAyHEAGHALVA  243 (389)
                      -||-||.|||+=-
T Consensus        94 aVAAHEVGHAiQd  106 (226)
T COG2738          94 AVAAHEVGHAIQD  106 (226)
T ss_pred             HHHHHHhhHHHhh
Confidence            4789999999854


No 49 
>PF11350 DUF3152:  Protein of unknown function (DUF3152);  InterPro: IPR022603 This entry represents Actinobacteria proteins of unknown function. Some are annotated as membrane proteins, however this cannot be confirmed.
Probab=23.99  E-value=38  Score=32.64  Aligned_cols=18  Identities=33%  Similarity=0.704  Sum_probs=16.1

Q ss_pred             hhhhHHHHHHHHhHHHHHH
Q 016447          226 PPYKRRILVHEAGHLLIAY  244 (389)
Q Consensus       226 ~~ekrRIAyHEAGHALVAy  244 (389)
                      ..||.-+.-||.||+| +|
T Consensus       136 ~~YRqYvINHEVGH~L-Gh  153 (203)
T PF11350_consen  136 ASYRQYVINHEVGHAL-GH  153 (203)
T ss_pred             HHHHHHhhhhhhhhhc-cc
Confidence            5899999999999999 55


No 50 
>PF01535 PPR:  PPR repeat;  InterPro: IPR002885 This entry represents the PPR repeat. Pentatricopeptide repeat (PPR) proteins are characterised by tandem repeats of a degenerate 35 amino acid motif []. Most of PPR proteins have roles in mitochondria or plastid []. PPR repeats were discovered while screening Arabidopsis proteins for those predicted to be targeted to mitochondria or chloroplast [, ]. Some of these proteins have been shown to play a role in post-transcriptional processes within organelles and they are thought to be sequence-specific RNA-binding proteins [, , ]. Plant genomes have between one hundred to five hundred PPR genes per genome whereas non-plant genomes encode two to six PPR proteins. Although no PPR structures are yet known, the motif is predicted to fold into a helix-turn-helix structure similar to those found in the tetratricopeptide repeat (TPR) family (see PDOC50005 from PROSITEDOC) [].  The plant PPR protein family has been divided in two subfamilies on the basis of their motif content and organisation [, ]. Examples of PPR repeat-containing proteins include PET309 P32522 from SWISSPROT, which may be involved in RNA stabilisation [], and crp1, which is involved in RNA processing []. The repeat is associated with a predicted plant protein O49549 from SWISSPROT that has a domain organisation similar to the human BRCA1 protein.
Probab=23.67  E-value=1.1e+02  Score=18.62  Aligned_cols=26  Identities=8%  Similarity=0.282  Sum_probs=23.5

Q ss_pred             HHHhhhccchHHHHHHHHHHHHhCCC
Q 016447          104 VLDTCLNADDLKLVASAYKFLQNRGF  129 (389)
Q Consensus       104 ~l~~~~~~~d~~~v~~~y~~l~~~G~  129 (389)
                      ++++|.+..+.+-+-+.|+.+++.|.
T Consensus         6 li~~~~~~~~~~~a~~~~~~M~~~g~   31 (31)
T PF01535_consen    6 LISGYCKMGQFEEALEVFDEMRERGI   31 (31)
T ss_pred             HHHHHHccchHHHHHHHHHHHhHCcC
Confidence            68999999999999999999999884


No 51 
>PF10579 Rapsyn_N:  Rapsyn N-terminal myristoylation and linker region;  InterPro: IPR019568  Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane. Rapsyn is a peripheral membrane protein that is selectively concentrated at the neuromuscular junction and is essential for the formation of synaptic acetylcholine receptor aggregates. Acetylcholine receptors fail to aggregate beneath nerve terminals in mice where rapsyn has been knocked out. The N-terminal six amino acids of rapsyn are its myristoylation site, and myristoylation is necessary for the targeting of the protein to the membrane []. ; GO: 0008270 zinc ion binding, 0033130 acetylcholine receptor binding, 0007268 synaptic transmission, 0005856 cytoskeleton, 0030054 cell junction, 0045211 postsynaptic membrane
Probab=23.05  E-value=77  Score=26.40  Aligned_cols=18  Identities=33%  Similarity=0.743  Sum_probs=15.0

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 016447           38 KYLARALKEWQEYEDAVK   55 (389)
Q Consensus        38 ~~~~~~~~~~~~~~~~~~   55 (389)
                      -||..|.-||..|+|+.+
T Consensus        47 G~l~qA~~e~Gkyr~~L~   64 (80)
T PF10579_consen   47 GYLIQAHMEWGKYREMLA   64 (80)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            377899999999999653


No 52 
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily. Hatching enzymes are secreted by teleost embryos to digest the egg envelope or chorion. In some teleosts, the hatching enzyme may be a system consisting of two evolutionary related  metalloproteases, high choriolytic enzyme and low choriolytic enzyme (HCE and LCE), which may have different  substrate specificities and cooperatively digest the chorion.
Probab=23.04  E-value=44  Score=31.30  Aligned_cols=16  Identities=38%  Similarity=0.395  Sum_probs=12.5

Q ss_pred             HHHHHHHHhHHHHHHH
Q 016447          230 RRILVHEAGHLLIAYL  245 (389)
Q Consensus       230 rRIAyHEAGHALVAyL  245 (389)
                      .-++.||.||||=-+=
T Consensus        78 ~G~i~HEl~HaLG~~H   93 (182)
T cd04283          78 KGIIQHELLHALGFYH   93 (182)
T ss_pred             cchHHHHHHHHhCCcc
Confidence            3689999999985543


No 53 
>PRK13379 protocatechuate 4,5-dioxygenase subunit alpha; Provisional
Probab=22.99  E-value=1.3e+02  Score=26.82  Aligned_cols=33  Identities=15%  Similarity=0.434  Sum_probs=26.1

Q ss_pred             chhhhHHHH---HHHHHHH---HHHHHHhhhcHHHHHHH
Q 016447           33 KPLRTKYLA---RALKEWQ---EYEDAVKRKDLARALRF   65 (389)
Q Consensus        33 ~~~~~~~~~---~~~~~~~---~~~~~~~~~~~~~~~~~   65 (389)
                      ..||.+.++   +.+.||.   |=.+||+++|..+.+++
T Consensus        38 ~~~RerF~aDe~ay~~~~~Lt~eqk~aV~~RDw~~mi~~   76 (119)
T PRK13379         38 APWRDRFLQDAEALMQEAGLTEQEKELIRARDWLGLVQY   76 (119)
T ss_pred             HHHHHHHHhCHHHHHHHcCCCHHHHHHHHhccHHHHHHc
Confidence            357888877   6778884   66789999999999954


No 54 
>PF13583 Reprolysin_4:  Metallo-peptidase family M12B Reprolysin-like
Probab=22.37  E-value=44  Score=31.41  Aligned_cols=15  Identities=33%  Similarity=0.357  Sum_probs=11.5

Q ss_pred             HHHHHHHhHHHHHHH
Q 016447          231 RILVHEAGHLLIAYL  245 (389)
Q Consensus       231 RIAyHEAGHALVAyL  245 (389)
                      .+..||.||.|=+.=
T Consensus       139 ~~~aHEiGH~lGl~H  153 (206)
T PF13583_consen  139 QTFAHEIGHNLGLRH  153 (206)
T ss_pred             hHHHHHHHHHhcCCC
Confidence            568899999876543


No 55 
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=21.91  E-value=47  Score=31.54  Aligned_cols=15  Identities=40%  Similarity=0.649  Sum_probs=11.8

Q ss_pred             HHHHHHHhHHHHHHH
Q 016447          231 RILVHEAGHLLIAYL  245 (389)
Q Consensus       231 RIAyHEAGHALVAyL  245 (389)
                      -++.||.||||=-+=
T Consensus        89 Gti~HEl~HaLGf~H  103 (200)
T cd04281          89 GIVVHELGHVIGFWH  103 (200)
T ss_pred             chHHHHHHHHhcCcc
Confidence            489999999985443


No 56 
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=21.75  E-value=64  Score=30.96  Aligned_cols=25  Identities=20%  Similarity=0.178  Sum_probs=20.3

Q ss_pred             CCCChhhhHHHHHHHHhHHHHHHHh
Q 016447          222 SSYWPPYKRRILVHEAGHLLIAYLM  246 (389)
Q Consensus       222 ~~ls~~ekrRIAyHEAGHALVAyLL  246 (389)
                      ..++++|-+-|.-||.||..-.+..
T Consensus       150 ~~l~~dEl~aVlaHElgHi~~rd~~  174 (302)
T COG0501         150 DLLNDDELEAVLAHELGHIKNRHTL  174 (302)
T ss_pred             hhCCHHHHHHHHHHHHHHHhcccHH
Confidence            3568999999999999998765543


No 57 
>cd04276 ZnMc_MMP_like_2 Zinc-dependent metalloprotease; MMP_like sub-family 2. A group of bacterial metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=21.62  E-value=59  Score=30.82  Aligned_cols=30  Identities=10%  Similarity=0.257  Sum_probs=18.7

Q ss_pred             ccccccccccccccccchhhhHHHHHHHHHHHHHH
Q 016447           17 QKCCFLFPQTLVQGKLKPLRTKYLARALKEWQEYE   51 (389)
Q Consensus        17 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   51 (389)
                      +.|.|-+....-    +.||+ .+..++++|.++=
T Consensus         8 ~pItyyI~~~~p----~~~r~-aI~~A~~~Wn~~f   37 (197)
T cd04276           8 EPIVYYLDNTFP----EKYRD-AIREGVLYWNKAF   37 (197)
T ss_pred             CCEEEEecCCCc----HHHHH-HHHHHHHHHHHHH
Confidence            455555544321    56654 5788999998864


No 58 
>PRK13267 archaemetzincin-like protein; Reviewed
Probab=21.40  E-value=52  Score=30.78  Aligned_cols=11  Identities=45%  Similarity=0.773  Sum_probs=8.9

Q ss_pred             HHHHHHHhHHH
Q 016447          231 RILVHEAGHLL  241 (389)
Q Consensus       231 RIAyHEAGHAL  241 (389)
                      +.+.||.||.|
T Consensus       127 k~~~HElGH~l  137 (179)
T PRK13267        127 KEVTHELGHTL  137 (179)
T ss_pred             HHHHHHHHHHc
Confidence            45999999973


No 59 
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting). The VHS domain, an essential part of Hrs/Vps27p, has a superhelical structure similar to the structure of ARM (Armadillo) repeats and is present at the N-termini of proteins. Hrs also contains a FYVE (Fab1p, YOTB, Vac1p, and EEA1) zinc finger domain C-terminal to VHS, as well as two coiled-coil domains. Hrs has been proposed to play a role in at least three vesicle trafficking events: exocytosis, endocytosis, and endosome to lysosome trafficking. Hrs is involved in promoting rapid recycling of endocytosed signaling receptors to the plasma membrane.
Probab=21.16  E-value=96  Score=27.69  Aligned_cols=27  Identities=30%  Similarity=0.560  Sum_probs=22.4

Q ss_pred             hhHHHHhhhccchHHHHHHHHHHHHhCCC
Q 016447          101 DWEVLDTCLNADDLKLVASAYKFLQNRGF  129 (389)
Q Consensus       101 ~~~~l~~~~~~~d~~~v~~~y~~l~~~G~  129 (389)
                      .|.  +++-+..|+..|.++|..|++.|.
T Consensus       111 ~W~--~~f~~~~~l~~i~~~y~~L~~~G~  137 (142)
T cd03569         111 AWA--LAFRNKPQLKYVVDTYQILKAEGH  137 (142)
T ss_pred             HHH--HHhCCCcccHHHHHHHHHHHHcCC
Confidence            454  456666799999999999999998


No 60 
>COG5549 Predicted Zn-dependent protease [Posttranslational modification, protein turnover, chaperones]
Probab=21.14  E-value=49  Score=32.42  Aligned_cols=19  Identities=26%  Similarity=0.118  Sum_probs=15.4

Q ss_pred             CChhhhHHHHHHHHhHHHH
Q 016447          224 YWPPYKRRILVHEAGHLLI  242 (389)
Q Consensus       224 ls~~ekrRIAyHEAGHALV  242 (389)
                      .+.++..-+|.||-||||=
T Consensus       182 ~~~e~L~~tarhElGhaLg  200 (236)
T COG5549         182 ELRENLNPTARHELGHALG  200 (236)
T ss_pred             cchhhhhHHHHHhhcchhe
Confidence            3567777899999999973


No 61 
>cd04275 ZnMc_pappalysin_like Zinc-dependent metalloprotease, pappalysin_like subfamily. The pregnancy-associated plasma protein A (PAPP-A or pappalysin-1) cleaves insulin-like growth factor-binding proteins 4 and 5, thereby promoting cell growth by releasing bound growth factor. This model includes pappalysins and related metalloprotease domains from all three kingdoms of life. The three-dimensional structure of an archaeal representative, ulilysin, has been solved.
Probab=20.80  E-value=15  Score=35.39  Aligned_cols=18  Identities=33%  Similarity=0.331  Sum_probs=14.3

Q ss_pred             hhhhHHHHHHHHhHHHHH
Q 016447          226 PPYKRRILVHEAGHLLIA  243 (389)
Q Consensus       226 ~~ekrRIAyHEAGHALVA  243 (389)
                      +...-+++.||.||.|--
T Consensus       134 ~~n~g~t~~HEvGH~lGL  151 (225)
T cd04275         134 PYNLGDTATHEVGHWLGL  151 (225)
T ss_pred             cccccceeEEeccceeee
Confidence            456678999999998743


No 62 
>PF01435 Peptidase_M48:  Peptidase family M48 This is family M48 in the peptidase classification. ;  InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated.  The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases [].  HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=20.75  E-value=71  Score=29.03  Aligned_cols=24  Identities=21%  Similarity=0.250  Sum_probs=19.7

Q ss_pred             CChhhhHHHHHHHHhHHHHHHHhC
Q 016447          224 YWPPYKRRILVHEAGHLLIAYLMG  247 (389)
Q Consensus       224 ls~~ekrRIAyHEAGHALVAyLLg  247 (389)
                      ++++|..-|.-||.||..-.+..-
T Consensus        84 ~~~~el~aVlaHElgH~~~~h~~~  107 (226)
T PF01435_consen   84 LSEDELAAVLAHELGHIKHRHILK  107 (226)
T ss_dssp             SSHHHHHHHHHHHHHHHHTTHCCC
T ss_pred             ccHHHHHHHHHHHHHHHHcCCcch
Confidence            468999999999999998666543


Done!