BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016454
         (389 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3DLD|A Chain A, Crystal Structure Of Peptide Deformylase, Xoo1075, From
           Xanthomonas Oryzae Pv. Oryzae Kacc10331
          Length = 171

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 27/67 (40%), Gaps = 19/67 (28%)

Query: 72  NNPIEPLSDSLMGESNRARLPEFVGGFDRDWEVLDTCLNADDLKLVASAYKFLQNRGFLP 131
           N  IEPLSD +                +  WE    CL+   L+ V   Y++++ RGF P
Sbjct: 82  NAQIEPLSDEM----------------ENGWE---GCLSIPGLRAVIPRYRYIRYRGFAP 122

Query: 132 SFGKFNR 138
                 R
Sbjct: 123 DGSPIER 129


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,074,534
Number of Sequences: 62578
Number of extensions: 443244
Number of successful extensions: 832
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 828
Number of HSP's gapped (non-prelim): 9
length of query: 389
length of database: 14,973,337
effective HSP length: 101
effective length of query: 288
effective length of database: 8,652,959
effective search space: 2492052192
effective search space used: 2492052192
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)