Citrus Sinensis ID: 016467


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGLRSLCTVWAQHLNEEVRRRFYKNWCKSKKKAFTKYTKKYETDDGKKDIQAQLEKMKKYCTVIRVLAHTQIRKMKGLKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLKA
cccccccccccccccccccccccccccccccccccccccccCEEEEcccccccEEEEECccccccccccccCEEEEEEEEcccEEEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHcEEEEEEEEEEEHHHHHHHccccccccEEEEEccccccHHHHHHHcccccccccccccccccEEEEEEEEECccccccEEEEccccccccccccccccccccccccccccccccccccccccCEEEEEEEEEEEccccccccccccccccccccccccccccccccccccEEEEEcccccccccEEEEEHHHHccccccccccccEEEEEccccccccccccHHHHHHccccccc
**********HGSLGFLPRK*******KVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGLRSLCTVWAQHLNEEVRRRFYKNWCKSKKKAFTKYTKKYETDDG*KDIQAQLEKMKKYCTVIRVLAHTQIRKMKGLKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKA*******MTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPLVVVGVVGYVKTPRGLRSLCTVWAQHLNEEVRRRFYKNWCKSKKKAFTKYTKKYETDDGKKDIQAQLEKMKKYCTVIRVLAHTQIRKMKGLKQKKAHLMEIQVNGGSVAQKVDFAYGFFEKQIPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKIYKLGKASQESHSAMTEFDRTEKDITPMGGFPHYGVVNEDYLLIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSKFGHGRFQTTQEKAKYYGRLKA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L3 The L3 protein is a component of the large subunit of cytoplasmic ribosomes.confidentP35684
60S ribosomal protein L3-B confidentP36584
60S ribosomal protein L3-2 confidentP22738

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain b
Confidence level:very confident
Coverage over the Query: 7-346
View the alignment between query and template
View the model in PyMOL