BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016495
(388 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3DA2|A Chain A, X-Ray Structure Of Human Carbonic Anhydrase 13 In Complex
With Inhibitor
pdb|3DA2|B Chain B, X-Ray Structure Of Human Carbonic Anhydrase 13 In Complex
With Inhibitor
Length = 262
Score = 28.5 bits (62), Expect = 7.0, Method: Compositional matrix adjust.
Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)
Query: 206 KSKG-LTRMQFF--LIVLAASFAYYSLPGYLF--PILTFFSWVCWAWPHSITAQQIG 257
K KG TR F L +L S+ Y++ PG L P+L +W+ P +I++QQ+
Sbjct: 170 KEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLA 226
>pdb|3CZV|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Xiii In
Complex With Acetazolamide
pdb|3CZV|B Chain B, Crystal Structure Of The Human Carbonic Anhydrase Xiii In
Complex With Acetazolamide
pdb|3D0N|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Xiii
pdb|3D0N|B Chain B, Crystal Structure Of Human Carbonic Anhydrase Xiii
Length = 264
Score = 28.5 bits (62), Expect = 7.3, Method: Compositional matrix adjust.
Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)
Query: 206 KSKG-LTRMQFF--LIVLAASFAYYSLPGYLF--PILTFFSWVCWAWPHSITAQQIG 257
K KG TR F L +L S+ Y++ PG L P+L +W+ P +I++QQ+
Sbjct: 171 KEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLA 227
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.140 0.454
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,373,904
Number of Sequences: 62578
Number of extensions: 461330
Number of successful extensions: 968
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 968
Number of HSP's gapped (non-prelim): 3
length of query: 388
length of database: 14,973,337
effective HSP length: 101
effective length of query: 287
effective length of database: 8,652,959
effective search space: 2483399233
effective search space used: 2483399233
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)