Citrus Sinensis ID: 016495

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39

MATKTQTESNENPNGDSTEERCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTFRTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLGWRFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEMWWPSNLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCWAWPHSITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCYWKFDTFDARKFPIFSNQLFTSSGHKYDTTKILTPQYDLNIPAYNSYGKLYLSPLFALSIGSGFARFTSTLTHVALFHGR

ccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccccEEcccEEEEccccccccccHHEEEEEccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccECccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHccccHHHHHcccccccEEECcccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHcccccEECccEEEcccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccc

********************RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTFRTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLGWRFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEMWWPSNLAQVSLFRALHEK****KGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCWAWPHSITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCYWKFDTFDARKFPIFSNQLFTSSGHKYDTTKILTPQYDLNIPAYNSYGKLYLSPLFALSIGSGFARFTSTLTHVALFHGR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Oligopeptide transporter 3	May be involved in the translocation of tetra- and pentapeptides across the cellular membrane in an energy-dependent manner. Acts also as a metal transporter that could be a component of the copper transport machinery. Essential for early embryo development.	probable	O23482

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted