Citrus Sinensis ID: 016496


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------39
MVTSVAGLLSSFSPNYVSLVIFRCFVGVGLGGVPVFLAYFLEFVPVSHRGRWMVALSAFWTAGTIFEASLAWVVMTRLNWRWLLAFSSVPSFALLLFYGLAPESPRYLCAKARTVDAHRILEKMAFVNQTKLPPGILVSDKAIKENEESNLLRDTHMLSMTRKITDKLKSGFSSFFMLFSRKLIRTTLLLWVLFFANVFSYYGAVLLTSKLSSGDNKCGSKVLHADKSKDNSLYVDVFIASLAELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTVLLFGVRMCVTGTITVATIYAPEIYPTSARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETMGRELKDTVDAIES
cHHHHHHHHHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHc
MVTSVAGLLSSFSPNYVSLVIFRCFVGVGLGGVPVFLAYFLEFVPVSHRGRWMVALSAFWTAGTIFEASLAWVVMTRLNWRWLLAFSSVPSFALLLFYGLAPESPRYLCAKARTVDAHRILEKMAFVNQTKLPPGILVSDK**************HMLSMTRKITDKLKSGFSSFFMLFSRKLIRTTLLLWVLFFANVFSYYGAVLLTSKLSSGDNKCGSKVLHADKSKDNSLYVDVFIASLAELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTVLLFGVRMCVTGTITVATIYAPEIYPTSARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETMGRELKD*******
xxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTSVAGLLSSFSPNYVSLVIFRCFVGVGLGGVPVFLAYFLEFVPVSHRGRWMVALSAFWTAGTIFEASLAWVVMTRLNWRWLLAFSSVPSFALLLFYGLAPESPRYLCAKARTVDAHRILEKMAFVNQTKLPPGILVSDKAIKENEESNLLRDTHMLSMTRKITDKLKSGFSSFFMLFSRKLIRTTLLLWVLFFANVFSYYGAVLLTSKLSSGDNKCGSKVLHADKSKDNSLYVDVFIASLAELPGLILSAIIVDKIGRKLSMVLMFVSACIFLLPLVFHQSAVVTTVLLFGVRMCVTGTITVATIYAPEIYPTSARTTGFGVASSLGKVGGMVCPLVAVGLVTSCHLRLAVILFEVVFVLAIASSLLFPFETMGRELKDTVDAIES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Organic cation/carnitine transporter 7 High affinity carnitine transporter involved in the active cellular uptake of carnitine. Also transports organic cations.probableQ940M4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:confident
Coverage over the Query: 12-130,142-154,168-214,226-386
View the alignment between query and template
View the model in PyMOL
Template: 4APS, chain A
Confidence level:confident
Coverage over the Query: 3-166,183-214,226-355
View the alignment between query and template
View the model in PyMOL