BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016521
(388 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1RW9|A Chain A, Crystal Structure Of The Arthrobacter Aurescens
Chondroitin Ac Lyase
Length = 757
Score = 28.1 bits (61), Expect = 7.7, Method: Compositional matrix adjust.
Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 7/73 (9%)
Query: 288 QWSGALALGATSAISHVVLGQFKTCIILLGNYYIFGANPGTTSIC-GAFVAIV-GMSFYT 345
+WSGA ALG +A+ ++G +T + ++++ G ++C GA ++ G T
Sbjct: 473 EWSGATALGEVAAVGQHLVGPGRTGLTARKSWFV----SGDVTVCLGADISTASGAKVET 528
Query: 346 YLNLCNSKHQSSK 358
++ N HQ S
Sbjct: 529 IVDHRN-LHQGSN 540
>pdb|1RWA|A Chain A, Crystal Structure Of Arthrobacter Aurescens Chondroitin Ac
Lyase
pdb|1RWC|A Chain A, Crystal Structure Of Arthrobacter Aurescens Chondroitin Ac
Lyase
pdb|1RWF|A Chain A, Crystal Structure Of Arthrobacter Aurescens Chondroitin Ac
Lyase In Complex With Chondroitin Tetrasaccharide
pdb|1RWG|A Chain A, Crystal Structure Of Arthrobacter Aurescens Chondroitin Ac
Lyase In Complex With Chondroitin Tetrasaccharide
pdb|1RWH|A Chain A, Crystal Structure Of Arthrobacter Aurescens Chondroitin Ac
Lyase In Complex With Chondroitin Tetrasaccharide
Length = 757
Score = 28.1 bits (61), Expect = 7.8, Method: Compositional matrix adjust.
Identities = 20/73 (27%), Positives = 37/73 (50%), Gaps = 7/73 (9%)
Query: 288 QWSGALALGATSAISHVVLGQFKTCIILLGNYYIFGANPGTTSIC-GAFVAIV-GMSFYT 345
+WSGA ALG +A+ ++G +T + ++++ G ++C GA ++ G T
Sbjct: 473 EWSGATALGEVAAVGQHLVGPGRTGLTARKSWFV----SGDVTVCLGADISTASGAKVET 528
Query: 346 YLNLCNSKHQSSK 358
++ N HQ S
Sbjct: 529 IVDHRN-LHQGSN 540
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.136 0.409
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,784,159
Number of Sequences: 62578
Number of extensions: 403159
Number of successful extensions: 778
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 776
Number of HSP's gapped (non-prelim): 5
length of query: 388
length of database: 14,973,337
effective HSP length: 101
effective length of query: 287
effective length of database: 8,652,959
effective search space: 2483399233
effective search space used: 2483399233
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)