BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016543
(387 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3E2Z|B Chain B, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii
In Complex With Kynurenine
pdb|3E2Y|A Chain A, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii
In Complex With Glutamine
pdb|3E2Y|B Chain B, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii
In Complex With Glutamine
Length = 410
Score = 28.1 bits (61), Expect = 9.8, Method: Compositional matrix adjust.
Identities = 31/114 (27%), Positives = 46/114 (40%), Gaps = 13/114 (11%)
Query: 175 LPGMWSLELVVG-GNKVIAGSDGKTVWRHTPWLGTHAAKGPQRPLRRIIQGLDPKITASL 233
LPGMW + +G K + + K W P H K Q + + A+L
Sbjct: 225 LPGMWERTITIGSAGKTFSVTGWKLGWSIGP---AHLIKHLQTVQQNSFYTCATPLQAAL 281
Query: 234 FAKAQCLGEKRIGDDECFV------LKVAADRAAVMERSEGPAEVIRHVLYGYF 281
A+A + KR+ D EC+ L+V DR + S G ++ GYF
Sbjct: 282 -AEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDG--GYF 332
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.134 0.412
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,484,497
Number of Sequences: 62578
Number of extensions: 454727
Number of successful extensions: 940
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 940
Number of HSP's gapped (non-prelim): 2
length of query: 387
length of database: 14,973,337
effective HSP length: 101
effective length of query: 286
effective length of database: 8,652,959
effective search space: 2474746274
effective search space used: 2474746274
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)