BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016543
         (387 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3E2Z|B Chain B, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii
           In Complex With Kynurenine
 pdb|3E2Y|A Chain A, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii
           In Complex With Glutamine
 pdb|3E2Y|B Chain B, Crystal Structure Of Mouse Kynurenine Aminotransferase Iii
           In Complex With Glutamine
          Length = 410

 Score = 28.1 bits (61), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 46/114 (40%), Gaps = 13/114 (11%)

Query: 175 LPGMWSLELVVG-GNKVIAGSDGKTVWRHTPWLGTHAAKGPQRPLRRIIQGLDPKITASL 233
           LPGMW   + +G   K  + +  K  W   P    H  K  Q   +         + A+L
Sbjct: 225 LPGMWERTITIGSAGKTFSVTGWKLGWSIGP---AHLIKHLQTVQQNSFYTCATPLQAAL 281

Query: 234 FAKAQCLGEKRIGDDECFV------LKVAADRAAVMERSEGPAEVIRHVLYGYF 281
            A+A  +  KR+ D EC+       L+V  DR   +  S G   ++     GYF
Sbjct: 282 -AEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDG--GYF 332


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.412 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,484,497
Number of Sequences: 62578
Number of extensions: 454727
Number of successful extensions: 940
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 940
Number of HSP's gapped (non-prelim): 2
length of query: 387
length of database: 14,973,337
effective HSP length: 101
effective length of query: 286
effective length of database: 8,652,959
effective search space: 2474746274
effective search space used: 2474746274
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)