Citrus Sinensis ID: 016556

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------

MTIISCLRTVSKPSLISQFSKPKPKTQQSCSLVVSSIVMSYDKELAAAKKAASLAARLCLKVQKALLQSDVQSKNDKSPVTVADYGSQALVSFALQKEFPSEPFSLVAEEDSKDLRQDGAQETLERITKLVNETLASDGAYNTSTLSTEDVIRAIDGGKSEGGSHGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGVLACPNLPLASIVGDNQHSSNNEVGCLFFAQVGAGTYMQSLSGSLPVKVQVTAIENSEEASFFESYEAAHSNRDLSSLIAKKLGVKAPPVRIDSQAKYGALSRGDGAIYLRFPRKGYREKIWDHAAGSIVVTEAGGVVTDAAGYPLDFSKGKHLNLQAGIIVTNQKLMPALLKAVKESLEEQASSL

ccEEEECcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEccccHHHHHccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccccccEEEEcccccccccccccccEEEEEEEEccEEEEEEEEccccccccccccccccccccccEEEEEEEcccEEEEcccccccccccccccccccccEEEECcccccccHHHHHHHHHHccccccccECccHHHHHHHHcccCEEEEEccccccccccccHHHHHHHHHHcccEEEcccccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHcc

*TII***RTV*************************SIVMSYDKELAAAKKAASLAARLCLKVQKALL**********SPVTVADYGSQALVSFALQKEFPSEPFSLVAEEDSKDLRQDGAQETLERITKLVNETLASDGAYNTSTLSTEDVIRAIDGG*SEGGSHGRHWVLDPIDGTKGFVRGDQYAIALALLDEGKVVLGVLACPNLPLASIVGDNQHSSNNEVGCLFFAQVGAGTYMQSLSGSLPVKVQVTAIE*SEEASFFESYEAAHSNRDLSSLIAKKLGVKAPPVRIDSQAKYGALSRGDGAIYLRFPRKGYREKIWDHAAGSIVVTEAGGVVTDAAGYPLDFSKGKHLNLQAGIIVTNQKLMPALLKAVKESL*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
3'(2'),5'-bisphosphate nucleotidase	Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS.	probable	P0C5A3
3'(2'),5'-bisphosphate nucleotidase	Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS.	probable	Q2QWT4
3'(2'),5'-bisphosphate nucleotidase	Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Regulates the flux of sulfur in the sulfur-activation pathway by converting PAPS to APS. Is also able to hydrolyze inositol 1,4-bisphosphate and inositol 1,3,4-trisphosphate.	probable	Q55F34

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.7	3'(2'),5'-bisphosphate nucleotidase.	probable
3.1.3.57	Inositol-1,4-bisphosphate 1-phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JP4, chain A
Confidence level:very confident
Coverage over the Query: 41-124,144-382
View the alignment between query and template
View the model in PyMOL

Template: 1KA1, chain A
Confidence level:very confident
Coverage over the Query: 40-383
View the alignment between query and template
View the model in PyMOL