Citrus Sinensis ID: 016570


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------
MIACLSSNLPNLHSTPTAPGQTTSEPDSKPQARKLKSSPQLNRWSRARAVRSGRKLDRLGHRSPQSSVNFKVRDRDGVDLEPERISDGEDNVEAMEGKSIYMVSDGTGWTAEHAVNAALGQFEHCLVDRNCAVNTHLFSGIDDVEQLMVIIKQAAKDGAMLVYTLADPSMAESAKKACELWGIPSTDVLGPITEAIASHLGVSPSGLPRGAPGRNFPLSEEYFRRIEAIEFTIKQDDGALPQNLQKADIILSGVSRTGKTPLSIYLAQKGYKVANVPIVMGVELPKSLFQVDPEKVFGLTINPLVLQSIRKARARSLGFRDEIRSNYSEMDYVREELEFAGRIFAQNPVWPVIEVTGKAIEETAAVVLRLYHDRKHKCSMPRISKRY
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHcccccEEEEEEccHHHHHHHHHHHHHcccccccccccccEEEEcccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccHHHHHHHHcccEEEEccccccccccccccccccccEEEEEccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHcccccccccccccc
**************************************************************************************************SIYMVSDGTGWTAEHAVNAALGQFEHCLVDRNCAVNTHLFSGIDDVEQLMVIIKQAAKDGAMLVYTLADPSMAESAKKACELWGIPSTDVLGPITEAIASHLGV*************FPLSEEYFRRIEAIEFTIKQDDGALPQNLQKADIILSGVSRTGKTPLSIYLAQKGYKVANVPIVMGVELPKSLFQVDPEKVFGLTINPLVLQSIRKARARSLGFRDEIRSNYSEMDYVREELEFAGRIFAQNPVWPVIEVTGKAIEETAAVVLRLYHDR*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIACLSSNLPNLHSTPTAPGQTTSEPDSKPQARKLKSSPQLNRWSRARAVRSGRKLDRLGHRSPQSSVNFKVRDRDGVDLEPERISDGEDNVEAMEGKSIYMVSDGTGWTAEHAVNAALGQFEHCLVDRNCAVNTHLFSGIDDVEQLMVIIKQAAKDGAMLVYTLADPSMAESAKKACELWGIPSTDVLGPITEAIASHLGVSPSGLPRGAPGRNFPLSEEYFRRIEAIEFTIKQDDGALPQNLQKADIILSGVSRTGKTPLSIYLAQKGYKVANVPIVMGVELPKSLFQVDPEKVFGLTINPLVLQSIRKARARSLGFRDEIRSNYSEMDYVREELEFAGRIFAQNPVWPVIEVTGKAIEETAAVVLRLYHDRKHKCSMPRISKRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyruvate, phosphate dikinase regulatory protein 1, chloroplastic Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation. Dark/light-induced changes in stromal concentrations of the competing ADP and Pi substrates govern the direction of the reaction. In the dark, phosphorylates the catalytic intermediate of PPDK (PPDK-HisP), inactivating it. Light exposure induces the phosphorolysis reaction that reactivates PPDK. Unlike the kinase function which can utilize either Thr or Ser as target, the phosphorylase function has a strict substrate requirement for threonyl phosphate.probableO49562
Pyruvate, phosphate dikinase regulatory protein, chloroplastic Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation. Dark/light-induced changes in stromal concentrations of the competing ADP and Pi substrates govern the direction of the reaction. In the dark, phosphorylates the catalytic intermediate of PPDK (PPDK-HisP), inactivating it. Light exposure induces the phosphorolysis reaction that reactivates PPDK.probableQ195N6
Probable pyruvate, phosphate dikinase regulatory protein, chloroplastic Bifunctional serine/threonine kinase and phosphorylase involved in the dark/light-mediated regulation of PPDK by catalyzing its phosphorylation/dephosphorylation. Dark/light-induced changes in stromal concentrations of the competing ADP and Pi substrates govern the direction of the reaction. In the dark, phosphorylates the catalytic intermediate of PPDK (PPDK-HisP), inactivating it. Light exposure induces the phosphorolysis reaction that reactivates PPDK.probableQ8GVP6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.n1probable
2.7.4.n1probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IIJ, chain A
Confidence level:confident
Coverage over the Query: 248-374
View the alignment between query and template
View the model in PyMOL
Template: 2CDN, chain A
Confidence level:probable
Coverage over the Query: 242-372
View the alignment between query and template
View the model in PyMOL
Template: 3ZVL, chain A
Confidence level:probable
Coverage over the Query: 147-274
View the alignment between query and template
View the model in PyMOL