BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016574
(387 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2P3E|A Chain A, Crystal Structure Of Aq1208 From Aquifex Aeolicus
pdb|2P3E|B Chain B, Crystal Structure Of Aq1208 From Aquifex Aeolicus
Length = 420
Score = 28.1 bits (61), Expect = 9.4, Method: Compositional matrix adjust.
Identities = 12/33 (36%), Positives = 19/33 (57%)
Query: 222 VLSGGFYPYIVGLHYQIRPSKHTLIADAGSVPI 254
VLS G Y + + HY +RP ++ + GSV +
Sbjct: 371 VLSAGAYGFAMSSHYNMRPRAAEVLVENGSVKL 403
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.135 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,451,397
Number of Sequences: 62578
Number of extensions: 275912
Number of successful extensions: 460
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 459
Number of HSP's gapped (non-prelim): 1
length of query: 387
length of database: 14,973,337
effective HSP length: 101
effective length of query: 286
effective length of database: 8,652,959
effective search space: 2474746274
effective search space used: 2474746274
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)