Citrus Sinensis ID: 016587

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------

MDAIMNKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSELRLYLNAVTETKLLVDTSRGETLRINFDVTFPALPCSILSVDAMDISGEQHLDVKHDIFKKRLDSQGNVIESRQDGIGAPKIDKPLQRHGGRLEHNETYCGSCYGAESSDEDCCNNCEEVREAYRKKGWALSNPDLIDQCKREGFLQRIKEEEGEGCNIYGFLEVNKVAGNFHFAPGKSFHQSGVHVHDILAFQRDSFNISHKINKLAFGEHFPGVVNPLDGVRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRSSEQGRLQTLPGVFFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKKKIEIGKFS

cHHHHHHcHHcccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEECcccccccEEEEEEEccccccccccccEEEEEEccccCEECccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHcccHHHcccccccCEEEEEEEEEEEEEEEEEEccccccccccCEEEEEcccccccccccEEEEEECccccccccccccccCEEEECccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEECccccccccccEEEEEEEcccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc

*****NKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSELRLYLNAVTETKLLVDTSRGETLRINFDVTFPALPCSILSVDAMDISGEQHLDVKHDIFKKRLDSQGNVIESRQDGIGAPK*****QR*GGRLEHNETYCGSCYGAESSDEDCCNNCEEVREAYRKKGWALSNPDLIDQCKREGFLQRIKEEEGEGCNIYGFLEVNKVAGNFHFAPGKSFHQSGVHVHDILAFQRDSFNISHKINKLAFGEHFPGVVNPLDGVRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFR***QGRLQTLPGVFFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKKKIEIGK**

xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable endoplasmic reticulum-Golgi intermediate compartment protein 3	Possible role in transport between endoplasmic reticulum and Golgi.	probable	Q54DW2
Endoplasmic reticulum-Golgi intermediate compartment protein 3	Possible role in transport between endoplasmic reticulum and Golgi.	probable	Q5EAE0
Endoplasmic reticulum-Golgi intermediate compartment protein 3	Possible role in transport between endoplasmic reticulum and Golgi.	probable	Q803I2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted