Citrus Sinensis ID: 016587


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MDAIMNKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSELRLYLNAVTETKLLVDTSRGETLRINFDVTFPALPCSILSVDAMDISGEQHLDVKHDIFKKRLDSQGNVIESRQDGIGAPKIDKPLQRHGGRLEHNETYCGSCYGAESSDEDCCNNCEEVREAYRKKGWALSNPDLIDQCKREGFLQRIKEEEGEGCNIYGFLEVNKVAGNFHFAPGKSFHQSGVHVHDILAFQRDSFNISHKINKLAFGEHFPGVVNPLDGVRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRSSEQGRLQTLPGVFFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKKKIEIGKFS
cHHHHHHcHHcccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEEECcccccccEEEEEEEccccccccccccEEEEEEccccCEECccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHcccHHHcccccccCEEEEEEEEEEEEEEEEEEccccccccccCEEEEEcccccccccccEEEEEECccccccccccccccCEEEECccccEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEECccccccccccEEEEEEEcccEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
*****NKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSELRLYLNAVTETKLLVDTSRGETLRINFDVTFPALPCSILSVDAMDISGEQHLDVKHDIFKKRLDSQGNVIESRQDGIGAPK*****QR*GGRLEHNETYCGSCYGAESSDEDCCNNCEEVREAYRKKGWALSNPDLIDQCKREGFLQRIKEEEGEGCNIYGFLEVNKVAGNFHFAPGKSFHQSGVHVHDILAFQRDSFNISHKINKLAFGEHFPGVVNPLDGVRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFR***QGRLQTLPGVFFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKKKIEIGK**
xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDAIMNKIRSLDAYPKINEDFYSRTFSGGVITLVSSIVMLLLFFSELRLYLNAVTETKLLVDTSRGETLRINFDVTFPALPCSILSVDAMDISGEQHLDVKHDIFKKRLDSQGNVIESRQDGIGAPKIDKPLQRHGGRLEHNETYCGSCYGAESSDEDCCNNCEEVREAYRKKGWALSNPDLIDQCKREGFLQRIKEEEGEGCNIYGFLEVNKVAGNFHFAPGKSFHQSGVHVHDILAFQRDSFNISHKINKLAFGEHFPGVVNPLDGVRWTQETPSGMYQYFIKVVPTVYTDVSGHTIQSNQFSVTEHFRSSEQGRLQTLPGVFFFYDLSPIKVTFTEEHVSFLHFLTNVCAIVGGVFTVSGIIDAFIYHGQRAIKKKIEIGKFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable endoplasmic reticulum-Golgi intermediate compartment protein 3 Possible role in transport between endoplasmic reticulum and Golgi.probableQ54DW2
Endoplasmic reticulum-Golgi intermediate compartment protein 3 Possible role in transport between endoplasmic reticulum and Golgi.probableQ5EAE0
Endoplasmic reticulum-Golgi intermediate compartment protein 3 Possible role in transport between endoplasmic reticulum and Golgi.probableQ803I2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted