Citrus Sinensis ID: 016588


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MSVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRSVSRTSETGSSEPSVQRNICIIAGRNVGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLFRATK
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEEEccccEEEEEEccccccHHHHHHHHHHHcccccccccEEEEEccccEEEEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccEEEcccccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEcHHHHHHHHccccHHccccccccccEEEcEcccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHEEEEEEccccEEEEEEEcccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEccHHHHEEccccccccHcHccHHEEcccccccEEEEEEEEccccccHHHHHcccEEEccHHHHHHHEHHHHHccccccccccccccHHHHHHHHHHHHcccHHHHccHHHcccccHHHHHHHHHHHHHHHcccHcccccHHHHHHHHHHHccccccccccccccccccccccccccccc
MSVTLAAIFGAAAGAVALMGIIFFLSWFCLyrnrsvsrtsetgssepsvqRNICIIAGRNVGIELSIREARRFQMEELSLATknfsdknligegkfgEVYKGLLQDGMLVAikkrpgaptqefIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEyipngsvsihlygpsqvsrqklEFKHRLSIALGAAKGLAhlhslsprvvhkdfktanvlVDEDFIAKVADAGLrnflgrtdvagpssqvtaDEIFLASEVKEFRrfseksdvySFGVFLLELVSgreassslspdssQDLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCldpsserrpsmsdVVTELDRTLDKEMNlttvmgegtptvtlgshlfratk
MSVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRSVsrtsetgssepsvqrniciiagrnvGIELSIREARRFQMEELSLAtknfsdknligeGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFlgrtdvagpssqvtadEIFLASEVKEFRrfseksdvYSFGVFLLELVSGREAssslspdssqDLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLdpsserrpsmsdvVTELDRTLDKEMnlttvmgegtptvtlgshlfratk
MSVTLaaifgaaagavalmgiiFFLSWFCLYRNRSVSRTSETGSSEPSVQRNICIIAGRNVGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIalgaakglahlhslsPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREAssslspdssqdlVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLFRATK
**************************************************RNICIIAGRNVGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELV*******************LVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCL*************************************************
**VTLAAIFGAAAGAVALMGIIFFLSWFC******************************************RFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRP*AP*QEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREAS******S**DLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRT*****************************
MSVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRS*************VQRNICIIAGRNVGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSG**************LVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLFRATK
*SVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRS*********************************EARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDK**************************
iiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRSVSRTSETGSSEPSVQRNICIIAGRNVGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMNLTTVMGEGTPTVTLGSHLFRATK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query386 2.2.26 [Sep-21-2011]
Q8LKZ1924 Nodulation receptor kinas N/A no 0.924 0.386 0.375 2e-58
Q8L4H4925 Nodulation receptor kinas N/A no 0.922 0.384 0.372 2e-56
Q9LX66830 Receptor-like protein kin no no 0.943 0.438 0.349 1e-51
Q9FFW5681 Proline-rich receptor-lik no no 0.764 0.433 0.379 5e-51
C0LGV0895 Probable LRR receptor-lik no no 0.725 0.312 0.406 5e-51
Q9SA72849 Probable receptor-like pr no no 0.740 0.336 0.375 1e-50
Q9SR05850 Receptor-like protein kin no no 0.873 0.396 0.343 5e-50
Q9CAL8710 Proline-rich receptor-lik no no 0.735 0.4 0.385 7e-50
Q9FID9880 Probable receptor-like pr no no 0.746 0.327 0.375 3e-49
Q9LK35855 Receptor-like protein kin no no 0.927 0.418 0.338 3e-49
>sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum GN=NORK PE=1 SV=1 Back     alignment and function desciption
 Score =  226 bits (576), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 206/365 (56%), Gaps = 8/365 (2%)

Query: 8   IFGAAAGAVALMGIIFFLSWFCLYRNRSVSRTSETGSSEPSVQRNICIIAGRNVGIELSI 67
           + GA      L+ +   + +FC YR++S++     G + P     I  +  ++     S+
Sbjct: 521 MIGAITSGSILITLAVVILFFCRYRHKSITLEGFGGKTYPMATNIIFSLPSKDDFFIKSV 580

Query: 68  REARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQ---EFI 124
              + F +E + LAT+ +  K LIGEG FG VY+G L DG  VA+K R    TQ   EF 
Sbjct: 581 -SVKPFTLEYIELATEKY--KTLIGEGGFGSVYRGTLDDGQEVAVKVRSATSTQGTREFD 637

Query: 125 DEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRL 184
           +E+  L++IQH NLV LLGYC E + Q L+Y ++ NGS+   LYG     R+ L++  RL
Sbjct: 638 NELNLLSAIQHENLVPLLGYCNEYDQQILVYPFMSNGSLLDRLYG-EPAKRKILDWPTRL 696

Query: 185 SIALGAAKGLAHLHSLSPR-VVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSS 243
           SIALGAA+GLA+LH+   R V+H+D K++N+L+D    AKVAD G   +  +   +  S 
Sbjct: 697 SIALGAARGLAYLHTFPGRSVIHRDVKSSNILLDHSMCAKVADFGFSKYAPQEGDSYVSL 756

Query: 244 QVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNS 303
           +V     +L  E  + ++ SEKSDV+SFGV LLE+VSGRE  +   P     LVE  +  
Sbjct: 757 EVRGTAGYLDPEYYKTQQLSEKSDVFSFGVVLLEIVSGREPLNIKRPRVEWSLVEWAKPY 816

Query: 304 RDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKEMN 363
              S + +I+D  +   +  E +   +++ ++CL+P S  RP M D+V EL+  L  E N
Sbjct: 817 IRASKVDEIVDPGIKGGYHAEALWRVVEVALQCLEPYSTYRPCMVDIVRELEDALIIENN 876

Query: 364 LTTVM 368
            +  M
Sbjct: 877 ASEYM 881




Involved in the perception of symbiotic fungi and bacteria and required for the calcium spiking. Part of the perception/transduction system leading to nodulation or mycorrhizal infection.
Pisum sativum (taxid: 3888)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8L4H4|NORK_MEDTR Nodulation receptor kinase OS=Medicago truncatula GN=NORK PE=1 SV=2 Back     alignment and function description
>sp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 1 OS=Arabidopsis thaliana GN=HERK1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FFW5|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8 OS=Arabidopsis thaliana GN=PERK8 PE=1 SV=1 Back     alignment and function description
>sp|C0LGV0|Y5487_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g48740 OS=Arabidopsis thaliana GN=At5g48740 PE=2 SV=1 Back     alignment and function description
>sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=1 SV=1 Back     alignment and function description
>sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAL8|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13 OS=Arabidopsis thaliana GN=PERK13 PE=2 SV=1 Back     alignment and function description
>sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1 Back     alignment and function description
>sp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query386
255543513381 serine/threonine protein kinase, putativ 0.987 1.0 0.777 1e-173
224069640378 predicted protein [Populus trichocarpa] 0.979 1.0 0.730 1e-161
351727579379 protein kinase family protein [Glycine m 0.930 0.947 0.751 1e-156
356571643379 PREDICTED: probable receptor-like protei 0.930 0.947 0.754 1e-156
225451635381 PREDICTED: nodulation receptor kinase [V 0.932 0.944 0.732 1e-155
147805741414 hypothetical protein VITISV_039777 [Viti 0.932 0.869 0.732 1e-155
388494484380 unknown [Lotus japonicus] 0.930 0.944 0.737 1e-153
357508461379 Nodulation receptor kinase [Medicago tru 0.930 0.947 0.710 1e-149
449452038379 PREDICTED: nodulation receptor kinase-li 0.981 1.0 0.686 1e-148
30688460380 protein kinase family protein [Arabidops 0.937 0.952 0.691 1e-145
>gi|255543513|ref|XP_002512819.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223547830|gb|EEF49322.1| serine/threonine protein kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  613 bits (1580), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 300/386 (77%), Positives = 338/386 (87%), Gaps = 5/386 (1%)

Query: 1   MSVTLAAIFGAAAGAVALMGIIFFLSWFCLYRNRSVSRTSETGSSEPSVQRNICIIAGRN 60
           MS TLAAI G AAG VAL+GI+ FL WFCL   +SVSRTSETGSS+PS+Q       GR+
Sbjct: 1   MSKTLAAILGGAAGVVALVGIVIFLIWFCLSHKKSVSRTSETGSSDPSIQ-----APGRH 55

Query: 61  VGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPT 120
           VG+ELS+REARRF+M+ELS ATKNF DKNLIG GKFGEVYKGLL DGMLVAIKKR GA +
Sbjct: 56  VGVELSLREARRFEMDELSHATKNFVDKNLIGIGKFGEVYKGLLNDGMLVAIKKRSGASS 115

Query: 121 QEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEF 180
           QEF+DEV +L+ IQHRN+VTLLGYCQENNLQFL+YEYIP+GSVS HLYGPSQ S  KLEF
Sbjct: 116 QEFVDEVRYLSPIQHRNIVTLLGYCQENNLQFLVYEYIPSGSVSSHLYGPSQFSDGKLEF 175

Query: 181 KHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAG 240
           KHRLSIALGAAKGLAHLHSLSPR+VHKDFKTANVLVDE+FIAKVADAGL NFLGR DVAG
Sbjct: 176 KHRLSIALGAAKGLAHLHSLSPRLVHKDFKTANVLVDENFIAKVADAGLPNFLGRVDVAG 235

Query: 241 PSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELV 300
           PSSQVTADEIF A EV+EFRRFS+K DV+SFGVFLLEL+SGREA+ S SPDSSQ+LVE V
Sbjct: 236 PSSQVTADEIFQAPEVREFRRFSDKGDVFSFGVFLLELLSGREATESPSPDSSQNLVEWV 295

Query: 301 QNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDK 360
           QN++D+S    ++D+RL + FT EGMEEFIQLI++CL+PSSERRPSMS VV ELDR L+K
Sbjct: 296 QNTQDYSAFSSVVDQRLGTRFTAEGMEEFIQLIIQCLEPSSERRPSMSYVVMELDRILEK 355

Query: 361 EMNLTTVMGEGTPTVTLGSHLFRATK 386
           EM LTTVMGEGTPTVTLGS LF+A+K
Sbjct: 356 EMTLTTVMGEGTPTVTLGSQLFKASK 381




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224069640|ref|XP_002303015.1| predicted protein [Populus trichocarpa] gi|222844741|gb|EEE82288.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351727579|ref|NP_001235374.1| protein kinase family protein [Glycine max] gi|223452478|gb|ACM89566.1| protein kinase family protein [Glycine max] Back     alignment and taxonomy information
>gi|356571643|ref|XP_003553985.1| PREDICTED: probable receptor-like protein kinase At1g30570-like [Glycine max] Back     alignment and taxonomy information
>gi|225451635|ref|XP_002277073.1| PREDICTED: nodulation receptor kinase [Vitis vinifera] gi|296082255|emb|CBI21260.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147805741|emb|CAN73905.1| hypothetical protein VITISV_039777 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388494484|gb|AFK35308.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|357508461|ref|XP_003624519.1| Nodulation receptor kinase [Medicago truncatula] gi|355499534|gb|AES80737.1| Nodulation receptor kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|449452038|ref|XP_004143767.1| PREDICTED: nodulation receptor kinase-like [Cucumis sativus] gi|449529349|ref|XP_004171662.1| PREDICTED: nodulation receptor kinase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|30688460|ref|NP_189304.2| protein kinase family protein [Arabidopsis thaliana] gi|332643680|gb|AEE77201.1| protein kinase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query386
TAIR|locus:2090797380 AT3G26700 [Arabidopsis thalian 0.981 0.997 0.622 7.2e-123
TAIR|locus:2156992946 AT5G49770 [Arabidopsis thalian 0.772 0.315 0.355 1.8e-43
TAIR|locus:2019863971 AT1G79620 [Arabidopsis thalian 0.836 0.332 0.328 1.1e-42
TAIR|locus:2157042953 AT5G49760 [Arabidopsis thalian 0.738 0.299 0.353 1.3e-42
TAIR|locus:2091980432 CDG1 "CONSTITUTIVE DIFFERENTIA 0.847 0.756 0.342 8.4e-42
TAIR|locus:2157002857 AT5G49780 [Arabidopsis thalian 0.735 0.331 0.346 8.8e-42
TAIR|locus:2159873681 PERK8 "proline-rich extensin-l 0.774 0.439 0.349 9.2e-42
TAIR|locus:2156549895 AT5G48740 [Arabidopsis thalian 0.751 0.324 0.345 5.8e-41
UNIPROTKB|O24585901 CR4 "Putative receptor protein 0.810 0.347 0.339 2.6e-40
TAIR|locus:2012325466 AT1G09440 [Arabidopsis thalian 0.727 0.603 0.341 4.2e-40
TAIR|locus:2090797 AT3G26700 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1208 (430.3 bits), Expect = 7.2e-123, P = 7.2e-123
 Identities = 241/387 (62%), Positives = 295/387 (76%)

Query:     1 MSVTLXXXXXXXXXXXXXXXXXFFLSWFCLYRNRSVSRTSETGSSEPSVQRNICIIAGRN 60
             MS  L                  FL WFC++R +++SRTSETGSS+PS Q       GRN
Sbjct:     1 MSAILAAAIGGAVGALALIALFVFLLWFCVFRRKNLSRTSETGSSDPSTQE------GRN 54

Query:    61 VGIELSIREARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPT 120
             V IELS+REARRF+MEEL+ ATK+F++K+LIG GKFGEVYKGLLQDG+LVAIKKRPG PT
Sbjct:    55 VAIELSMREARRFEMEELAQATKSFTNKSLIGIGKFGEVYKGLLQDGVLVAIKKRPGLPT 114

Query:   121 QEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPS-QVSRQKLE 179
             QEF++EV +L+SI HRNLVTLLG+CQE+N QFL+YEY+PNGSVS HLYG   +V   +LE
Sbjct:   115 QEFVNEVRYLSSIHHRNLVTLLGFCQESNTQFLVYEYVPNGSVSSHLYGAGGKVPGNRLE 174

Query:   180 FKHRLSIXXXXXXXXXXXXXXXPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVA 239
             F+HRL+I               PR++HKDFKTANVLVDE+FIAKVADAG+RNFLGR DV 
Sbjct:   175 FRHRLAISIGAAKGLAHLHSLSPRLIHKDFKTANVLVDENFIAKVADAGVRNFLGREDV- 233

Query:   240 GPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREAXXXXXXXXXXXXVEL 299
             G SS + AD+IFL+ EV+EF+RFSEKSDVY+FGVFLLELVSGREA            V+ 
Sbjct:   234 GTSSHIVADQIFLSPEVQEFKRFSEKSDVYAFGVFLLELVSGREASEPSPSSSTQTLVDW 293

Query:   300 VQNSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLD 359
             +QN  D++++  ++DERL  T+T EG+EE I L +RC+D SSE+RP+MS VVTEL+R LD
Sbjct:   294 MQNLTDYADIPMMIDERLGGTYTAEGVEELITLTLRCVDVSSEKRPTMSFVVTELERILD 353

Query:   360 KEMNLTTVMGEGTPTVTLGSHLFRATK 386
             KE++LTTVMGEGTPTVTLGS LF+ATK
Sbjct:   354 KEVSLTTVMGEGTPTVTLGSQLFKATK 380




GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
TAIR|locus:2156992 AT5G49770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019863 AT1G79620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157042 AT5G49760 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2091980 CDG1 "CONSTITUTIVE DIFFERENTIAL GROWTH 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157002 AT5G49780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2159873 PERK8 "proline-rich extensin-like receptor kinase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2156549 AT5G48740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O24585 CR4 "Putative receptor protein kinase CRINKLY4" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms
TAIR|locus:2012325 AT1G09440 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.824
3rd Layer2.7.110.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pm.C_LG_II1100
hypothetical protein (378 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query386
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 6e-49
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 1e-47
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-47
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 1e-45
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 4e-39
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-38
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-38
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 3e-32
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 1e-29
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 1e-28
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 4e-28
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-27
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-26
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 5e-26
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-25
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 1e-25
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-25
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 2e-25
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-25
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 2e-24
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-24
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 4e-24
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 7e-24
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-23
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-23
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 1e-23
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 2e-23
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 6e-23
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-22
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 2e-22
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 2e-22
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 3e-22
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 5e-22
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 6e-22
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-21
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-21
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 7e-21
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 1e-20
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-20
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 2e-20
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-20
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 5e-20
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 6e-20
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 7e-20
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 1e-19
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 2e-19
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-19
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 2e-19
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-19
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 2e-19
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 4e-19
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 6e-19
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 7e-19
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 8e-19
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 8e-19
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 1e-18
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-18
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 2e-18
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 3e-18
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 4e-18
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 4e-18
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-18
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 5e-18
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 6e-18
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 6e-18
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 7e-18
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 8e-18
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 9e-18
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 1e-17
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 2e-17
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 2e-17
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 2e-17
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 3e-17
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-17
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 4e-17
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 4e-17
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 5e-17
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 5e-17
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 7e-17
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 8e-17
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 1e-16
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 2e-16
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-16
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 3e-16
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 3e-16
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 3e-16
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 4e-16
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 5e-16
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 6e-16
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 7e-16
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 8e-16
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 8e-16
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 9e-16
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 1e-15
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 1e-15
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-15
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-15
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 1e-15
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 2e-15
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 3e-15
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 3e-15
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 3e-15
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 3e-15
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 5e-15
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 6e-15
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 7e-15
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-14
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 2e-14
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 3e-14
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 5e-14
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 6e-14
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 6e-14
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 6e-14
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 8e-14
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-13
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 1e-13
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 1e-13
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-13
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 3e-13
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 3e-13
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 4e-13
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 6e-13
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 7e-13
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 7e-13
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 8e-13
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 9e-13
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 2e-12
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 2e-12
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 3e-12
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 3e-12
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 4e-12
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 4e-12
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 4e-12
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 8e-12
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 1e-11
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 1e-11
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 1e-11
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-11
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 2e-11
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-11
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 4e-11
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 6e-11
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 7e-11
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 7e-11
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 9e-11
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 2e-10
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-10
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 3e-10
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 4e-10
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 4e-10
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 5e-10
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 6e-10
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 7e-10
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 7e-10
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 7e-10
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 8e-10
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 9e-10
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 1e-09
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 1e-09
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-09
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-09
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 2e-09
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 2e-09
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 3e-09
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 4e-09
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 4e-09
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 6e-09
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 1e-08
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 2e-08
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 3e-08
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 4e-08
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 5e-08
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 5e-08
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 5e-08
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 6e-08
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 9e-08
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 1e-07
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 2e-07
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 2e-07
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 2e-07
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 3e-07
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 4e-07
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 4e-07
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 4e-07
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 4e-07
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 7e-07
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 8e-07
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 9e-07
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 1e-06
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-06
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 1e-06
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 1e-06
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 1e-06
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 1e-06
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-06
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 1e-06
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 2e-06
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-06
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 2e-06
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-06
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 3e-06
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 3e-06
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 3e-06
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 3e-06
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 3e-06
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-06
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 3e-06
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 3e-06
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 5e-06
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 6e-06
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 6e-06
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 7e-06
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 7e-06
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 9e-06
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 9e-06
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 1e-05
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 1e-05
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 1e-05
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 1e-05
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 1e-05
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 2e-05
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-05
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 2e-05
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 2e-05
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-05
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 2e-05
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 2e-05
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 2e-05
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 2e-05
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 3e-05
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 3e-05
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 3e-05
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 3e-05
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 3e-05
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 3e-05
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 3e-05
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 4e-05
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 5e-05
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 7e-05
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 7e-05
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 8e-05
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 8e-05
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 8e-05
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 9e-05
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 1e-04
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 1e-04
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 1e-04
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 1e-04
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 2e-04
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 2e-04
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-04
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 2e-04
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 2e-04
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 2e-04
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 2e-04
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 2e-04
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 2e-04
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 2e-04
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphot 3e-04
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 3e-04
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 3e-04
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 4e-04
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 4e-04
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 4e-04
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 4e-04
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 5e-04
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 5e-04
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 6e-04
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 7e-04
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 8e-04
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 0.001
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 0.001
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 0.002
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 0.002
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 0.004
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 0.004
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 0.004
cd05077262 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) do 0.004
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
 Score =  165 bits (421), Expect = 6e-49
 Identities = 82/275 (29%), Positives = 129/275 (46%), Gaps = 35/275 (12%)

Query: 91  IGEGKFGEVYKGLLQD-----GMLVAIKK-RPGAPTQ---EFIDEVCFLASIQHRNLVTL 141
           +GEG FGEVYKG L+       + VA+K  +  A  Q   EF+ E   +  + H N+V L
Sbjct: 7   LGEGAFGEVYKGKLKGKGGKKKVEVAVKTLKEDASEQQIEEFLREARIMRKLDHPNVVKL 66

Query: 142 LGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLS 201
           LG C E    +++ EY+  G +  +L    + +R KL     LS AL  A+G+ +L S  
Sbjct: 67  LGVCTEEEPLYIVMEYMEGGDLLSYL----RKNRPKLSLSDLLSFALQIARGMEYLESK- 121

Query: 202 PRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEIF-LASEVKEFR 260
              +H+D    N LV E+ + K++D GL   L   D      +     I  +A E  +  
Sbjct: 122 -NFIHRDLAARNCLVGENLVVKISDFGLSRDLYDDDYY--RKRGGKLPIRWMAPESLKEG 178

Query: 261 RFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWST 320
           +F+ KSDV+SFGV L E+ +           S+++++E ++N             RL   
Sbjct: 179 KFTSKSDVWSFGVLLWEIFTL--GEQPYPGMSNEEVLEYLKN-----------GYRLPQP 225

Query: 321 FTNEGM-EEFIQLIVRCLDPSSERRPSMSDVVTEL 354
                   E   L+++C     E RP+ S++V  L
Sbjct: 226 ---PNCPPELYDLMLQCWAEDPEDRPTFSELVEIL 257


Phosphotransferases. Tyrosine-specific kinase subfamily. Length = 257

>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|240159 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173643 cd05077, PTK_Jak1_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 386
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
PHA02988283 hypothetical protein; Provisional 100.0
KOG0201 467 consensus Serine/threonine protein kinase [Signal 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 100.0
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 100.0
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 100.0
PLN00113968 leucine-rich repeat receptor-like protein kinase; 100.0
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 100.0
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 100.0
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 100.0
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 100.0
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 100.0
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 100.0
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 100.0
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 100.0
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 100.0
KOG1989 738 consensus ARK protein kinase family [Signal transd 100.0
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 100.0
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 100.0
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 100.0
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 100.0
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 100.0
PTZ00267 478 NIMA-related protein kinase; Provisional 100.0
KOG0589 426 consensus Serine/threonine protein kinase [General 100.0
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 100.0
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 100.0
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 100.0
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
PTZ00283 496 serine/threonine protein kinase; Provisional 100.0
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 100.0
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 100.0
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 100.0
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 100.0
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 100.0
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 100.0
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 100.0
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 100.0
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 100.0
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 100.0
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 100.0
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 100.0
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 100.0
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 100.0
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 100.0
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 100.0
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 100.0
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 100.0
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 100.0
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 100.0
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 100.0
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 100.0
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 100.0
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 100.0
KOG2052513 consensus Activin A type IB receptor, serine/threo 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 100.0
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 100.0
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
PTZ00284467 protein kinase; Provisional 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 100.0
KOG0200609 consensus Fibroblast/platelet-derived growth facto 100.0
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 100.0
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 100.0
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 100.0
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 100.0
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
KOG0596677 consensus Dual specificity; serine/threonine and t 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
KOG0584 632 consensus Serine/threonine protein kinase [General 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 100.0
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
KOG4717 864 consensus Serine/threonine protein kinase [Signal 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 100.0
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 100.0
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 100.0
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 100.0
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 100.0
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 100.0
PHA02882294 putative serine/threonine kinase; Provisional 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 100.0
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 100.0
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 100.0
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 100.0
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 100.0
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 100.0
KOG0690516 consensus Serine/threonine protein kinase [Signal 100.0
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 100.0
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 100.0
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
KOG0586 596 consensus Serine/threonine protein kinase [General 100.0
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 100.0
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 100.0
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 100.0
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 100.0
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 100.0
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 100.0
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 100.0
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 100.0
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 100.0
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 100.0
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 100.0
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 100.0
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 100.0
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 100.0
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 100.0
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 100.0
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 100.0
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 100.0
KOG0607463 consensus MAP kinase-interacting kinase and relate 100.0
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 100.0
KOG0696683 consensus Serine/threonine protein kinase [Signal 100.0
KOG0671415 consensus LAMMER dual specificity kinases [Signal 100.0
KOG1151775 consensus Tousled-like protein kinase [Signal tran 100.0
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 100.0
KOG1027 903 consensus Serine/threonine protein kinase and endo 100.0
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 100.0
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 100.0
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 100.0
PLN03224507 probable serine/threonine protein kinase; Provisio 100.0
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 100.0
KOG0695593 consensus Serine/threonine protein kinase [Signal 100.0
KOG06081034 consensus Warts/lats-like serine threonine kinases 100.0
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.98
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.97
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.97
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.97
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.97
KOG1152772 consensus Signal transduction serine/threonine kin 99.97
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.97
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.96
KOG1167418 consensus Serine/threonine protein kinase of the C 99.96
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.96
PLN00181 793 protein SPA1-RELATED; Provisional 99.95
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.95
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.93
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.93
PRK09188365 serine/threonine protein kinase; Provisional 99.92
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.91
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.91
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.9
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.9
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.89
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.88
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.88
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.86
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.86
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.85
PRK12274218 serine/threonine protein kinase; Provisional 99.85
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.83
PRK10345210 hypothetical protein; Provisional 99.82
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.82
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.82
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.82
smart00090237 RIO RIO-like kinase. 99.8
PRK14879211 serine/threonine protein kinase; Provisional 99.77
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.76
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.75
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.75
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.74
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.66
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.66
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.64
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.63
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.57
KOG1266458 consensus Protein kinase [Signal transduction mech 99.55
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.5
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.41
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.38
KOG1243 690 consensus Protein kinase [General function predict 99.35
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.3
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.28
KOG06061205 consensus Microtubule-associated serine/threonine 99.24
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.22
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.22
KOG3087229 consensus Serine/threonine protein kinase [General 99.14
KOG3741655 consensus Poly(A) ribonuclease subunit [RNA proces 99.01
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.95
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.91
KOG2137 700 consensus Protein kinase [Signal transduction mech 98.88
COG4248 637 Uncharacterized protein with protein kinase and he 98.88
COG0478304 RIO-like serine/threonine protein kinase fused to 98.82
PRK09902216 hypothetical protein; Provisional 98.63
COG0661517 AarF Predicted unusual protein kinase [General fun 98.62
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.59
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.43
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.42
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.38
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.33
KOG1235538 consensus Predicted unusual protein kinase [Genera 98.26
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.24
PLN02876 822 acyl-CoA dehydrogenase 98.18
PF01636239 APH: Phosphotransferase enzyme family This family 98.14
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 98.02
PRK10593297 hypothetical protein; Provisional 97.93
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 97.91
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 97.89
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.87
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 97.78
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.74
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 97.7
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 97.69
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.62
PRK05231319 homoserine kinase; Provisional 97.61
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 97.59
PRK09550401 mtnK methylthioribose kinase; Reviewed 97.5
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 97.36
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 97.22
KOG2268465 consensus Serine/threonine protein kinase [Signal 97.08
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 97.06
KOG1826 2724 consensus Ras GTPase activating protein RasGAP/neu 97.0
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 96.86
PLN02756418 S-methyl-5-thioribose kinase 96.47
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 96.43
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 96.35
KOG1093 725 consensus Predicted protein kinase (contains TBC a 96.32
KOG2270520 consensus Serine/threonine protein kinase involved 96.31
TIGR02904309 spore_ysxE spore coat protein YsxE. Members of thi 96.19
PLN02236344 choline kinase 96.07
COG3001286 Uncharacterized protein conserved in bacteria [Fun 96.04
PF01102122 Glycophorin_A: Glycophorin A; InterPro: IPR001195 95.96
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 95.67
COG2334331 Putative homoserine kinase type II (protein kinase 95.42
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 95.42
KOG1236565 consensus Predicted unusual protein kinase [Genera 95.3
PF0243938 Adeno_E3_CR2: Adenovirus E3 region protein CR2; In 95.27
PRK11768325 serine/threonine protein kinase; Provisional 95.17
COG3231266 Aph Aminoglycoside phosphotransferase [Translation 94.17
PRK06148 1013 hypothetical protein; Provisional 94.14
PRK12396409 5-methylribose kinase; Reviewed 93.85
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.3e-54  Score=403.20  Aligned_cols=286  Identities=44%  Similarity=0.731  Sum_probs=248.6

Q ss_pred             hhcccCHHHHHHHhcCCCcCCeecccCceEEEEEEeCCCcEEEEEECCCCC---hhHHHHHHHHHHcCCCCcccccccce
Q 016588           69 EARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAP---TQEFIDEVCFLASIQHRNLVTLLGYC  145 (386)
Q Consensus        69 ~~~~~~~~~~~~~~~~~~~~~~lg~G~~g~V~~~~~~~~~~vavK~~~~~~---~~~~~~e~~~l~~l~h~niv~~~~~~  145 (386)
                      ..+.|++.++..+|++|...+.||+|+||.||+|..+++..||||+.....   ..+|.+|++++.+++|||+++++|||
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~ls~l~H~Nlv~LlGyC  140 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEILSRLRHPNLVKLLGYC  140 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHHhcCCCcCcccEEEEE
Confidence            456799999999999999999999999999999999988999999866544   46799999999999999999999999


Q ss_pred             eeCC-eEEEEEEeecCCCccccccCCCcCCCCCCCHHHHHHHHHHHHHHHHHhhcC-CCCceecCCCCCCeeeCCCCceE
Q 016588          146 QENN-LQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSL-SPRVVHKDFKTANVLVDEDFIAK  223 (386)
Q Consensus       146 ~~~~-~~~lv~e~~~~g~L~~~l~~~~~~~~~~l~~~~~~~i~~~i~~~l~~LH~~-~~~ivH~dlkp~Nill~~~~~~k  223 (386)
                      .+.+ ..+||+||+++|+|.++++.....   .++|..+++||.++|+||+|||.. .+.|+||||||+|||||+++++|
T Consensus       141 ~e~~~~~~LVYEym~nGsL~d~L~~~~~~---~L~W~~R~kIa~g~A~gL~yLH~~~~~~iiHrDiKssNILLD~~~~aK  217 (361)
T KOG1187|consen  141 LEGGEHRLLVYEYMPNGSLEDHLHGKKGE---PLDWETRLKIALGAARGLAYLHEGCPPPIIHRDIKSSNILLDEDFNAK  217 (361)
T ss_pred             ecCCceEEEEEEccCCCCHHHHhCCCCCC---CCCHHHHHHHHHHHHHHHHHHccCCCCCEecCCCCHHHeeECCCCCEE
Confidence            9988 599999999999999999865322   889999999999999999999984 34799999999999999999999


Q ss_pred             EcccccccccCCCCCCCCCccc-cCcccccchhhhcccCCCcccchhhHHHHHHHHHcCCCCCCCCCCCchhhHHHHHHh
Q 016588          224 VADAGLRNFLGRTDVAGPSSQV-TADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQN  302 (386)
Q Consensus       224 l~DFgl~~~~~~~~~~~~~~~~-~~~~~y~aPE~~~~~~~~~~~DvwSlGvil~el~tg~~p~~~~~~~~~~~~~~~~~~  302 (386)
                      |+|||+++.....  ....... .||.+|+|||+......+.++|||||||+++|++||+.|.+...+.....+.+|...
T Consensus       218 lsDFGLa~~~~~~--~~~~~~~~~gt~gY~~PEy~~~g~lt~KsDVySFGVvllElitgr~~~d~~~~~~~~~l~~w~~~  295 (361)
T KOG1187|consen  218 LSDFGLAKLGPEG--DTSVSTTVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRKAVDQSRPRGELSLVEWAKP  295 (361)
T ss_pred             ccCccCcccCCcc--ccceeeecCCCCccCChhhhccCCcCcccccccchHHHHHHHhCCcccCCCCCcccccHHHHHHH
Confidence            9999999665431  1111112 789999999999988999999999999999999999988887665555668888877


Q ss_pred             hhcccchhhhcchhhc-ccCCH-HHHHHHHHHHhHccCCCCCCCCCHHHHHHHHHHhhh
Q 016588          303 SRDFSNLLKILDERLW-STFTN-EGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLD  359 (386)
Q Consensus       303 ~~~~~~~~~~~~~~~~-~~~~~-~~~~~l~~li~~cl~~dp~~Rpt~~evl~~L~~~~~  359 (386)
                      ......+.+++|+.+. ..++. .....+..++.+|++.+|++||+|.||++.|+.+..
T Consensus       296 ~~~~~~~~eiiD~~l~~~~~~~~~~~~~~~~~a~~C~~~~~~~RP~m~~Vv~~L~~~~~  354 (361)
T KOG1187|consen  296 LLEEGKLREIVDPRLKEGEYPDEKEVKKLAELALRCLRPDPKERPTMSQVVKELEGILS  354 (361)
T ss_pred             HHHCcchhheeCCCccCCCCChHHHHHHHHHHHHHHcCcCCCcCcCHHHHHHHHHhhcc
Confidence            7777789999999987 55554 567789999999999999999999999999965553



>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02904 spore_ysxE spore coat protein YsxE Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>COG3001 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>KOG1236 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PF02439 Adeno_E3_CR2: Adenovirus E3 region protein CR2; InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host [] Back     alignment and domain information
>PRK11768 serine/threonine protein kinase; Provisional Back     alignment and domain information
>COG3231 Aph Aminoglycoside phosphotransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query386
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 1e-38
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 2e-38
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 1e-35
3uim_A326 Structural Basis For The Impact Of Phosphorylation 1e-35
2nry_A307 Crystal Structure Of Irak-4 Length = 307 2e-21
2nru_A307 Crystal Structure Of Irak-4 Length = 307 6e-21
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 4e-20
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 2e-19
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 1e-17
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 2e-17
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 4e-17
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 4e-17
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 5e-17
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 6e-17
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 6e-17
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 7e-17
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 7e-17
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 9e-17
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 1e-16
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 1e-16
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 1e-16
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 1e-16
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 1e-16
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 1e-16
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 1e-16
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 1e-16
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 1e-16
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 1e-16
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 2e-16
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 2e-16
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 2e-16
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 2e-16
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 2e-16
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 2e-16
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 2e-16
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 2e-16
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 2e-16
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 2e-16
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 4e-16
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 5e-16
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 5e-16
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 8e-16
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 1e-15
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 2e-15
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 2e-15
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 4e-15
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 2e-14
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 2e-14
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 2e-14
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 2e-14
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 2e-14
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 2e-14
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 2e-14
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 2e-14
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 2e-14
3a4o_X286 Lyn Kinase Domain Length = 286 2e-14
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 2e-14
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-14
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 3e-14
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 3e-14
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 3e-14
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 3e-14
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 3e-14
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 3e-14
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 3e-14
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 3e-14
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 3e-14
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 4e-14
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 4e-14
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 4e-14
4h58_A275 Braf In Complex With Compound 3 Length = 275 4e-14
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 4e-14
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 4e-14
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 4e-14
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 6e-14
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 6e-14
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 6e-14
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 6e-14
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 6e-14
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 6e-14
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 6e-14
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 6e-14
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 7e-14
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 7e-14
2pl0_A289 Lck Bound To Imatinib Length = 289 7e-14
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 7e-14
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 7e-14
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 7e-14
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 7e-14
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 7e-14
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 8e-14
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 8e-14
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 8e-14
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 1e-13
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 1e-13
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 1e-13
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 1e-13
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 1e-13
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 1e-13
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 2e-13
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 2e-13
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-13
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-13
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-13
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-13
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 2e-13
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 2e-13
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-13
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-13
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-13
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-13
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-13
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 2e-13
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-13
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 2e-13
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 2e-13
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 2e-13
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-13
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 2e-13
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-13
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 3e-13
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 3e-13
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 3e-13
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-13
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-13
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 3e-13
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 3e-13
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 4e-13
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 4e-13
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 4e-13
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 5e-13
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 5e-13
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 5e-13
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 5e-13
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 5e-13
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 5e-13
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 5e-13
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 6e-13
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 6e-13
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 6e-13
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 6e-13
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 6e-13
3dzq_A361 Human Epha3 Kinase Domain In Complex With Inhibitor 6e-13
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 7e-13
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 7e-13
3fxx_A371 Human Epha3 Kinase And Juxtamembrane Region Bound T 8e-13
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 8e-13
2qof_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 9e-13
2qod_A373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 9e-13
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 9e-13
2qoo_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 9e-13
2gsf_A373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 9e-13
2qoi_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 9e-13
2qok_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 1e-12
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 1e-12
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-12
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 1e-12
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 1e-12
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 1e-12
2qol_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 1e-12
1fvr_A327 Tie2 Kinase Domain Length = 327 1e-12
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 1e-12
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 1e-12
3b2t_A311 Structure Of Phosphotransferase Length = 311 1e-12
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 1e-12
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 1e-12
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 1e-12
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 1e-12
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 1e-12
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 1e-12
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 2e-12
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-12
2g15_A318 Structural Characterization Of Autoinhibited C-Met 2e-12
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 2e-12
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 2e-12
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-12
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-12
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 2e-12
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 2e-12
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 2e-12
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-12
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 2e-12
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 2e-12
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 2e-12
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 2e-12
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 2e-12
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 2e-12
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-12
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 4e-12
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 4e-12
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 4e-12
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 5e-12
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 5e-12
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 5e-12
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 6e-12
2qon_A373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 7e-12
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 8e-12
2qo7_A373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 9e-12
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 1e-11
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 1e-11
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-11
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 2e-11
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 2e-11
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 2e-11
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 2e-11
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 2e-11
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 4e-11
3kex_A325 Crystal Structure Of The Catalytically Inactive Kin 4e-11
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 4e-11
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 4e-11
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 4e-11
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 4e-11
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 4e-11
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 4e-11
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 4e-11
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 4e-11
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 4e-11
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 4e-11
3lmg_A344 Crystal Structure Of The Erbb3 Kinase Domain In Com 4e-11
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 4e-11
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 5e-11
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 5e-11
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 5e-11
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 5e-11
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 5e-11
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-11
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 5e-11
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 5e-11
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 5e-11
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 5e-11
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 5e-11
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 5e-11
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 5e-11
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 5e-11
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 5e-11
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 5e-11
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 5e-11
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 5e-11
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 5e-11
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 6e-11
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 6e-11
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 6e-11
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 6e-11
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-11
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 6e-11
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 6e-11
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 6e-11
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 6e-11
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 6e-11
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 6e-11
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 7e-11
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 7e-11
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 7e-11
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 7e-11
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 7e-11
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 8e-11
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 8e-11
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 8e-11
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 9e-11
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 9e-11
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 1e-10
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 1e-10
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 1e-10
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 1e-10
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 1e-10
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 1e-10
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-10
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 1e-10
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 1e-10
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-10
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 1e-10
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-10
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 1e-10
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 2e-10
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 2e-10
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-10
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-10
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-10
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 2e-10
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-10
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 2e-10
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 2e-10
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 2e-10
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 3e-10
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 3e-10
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 3e-10
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 3e-10
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 3e-10
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 3e-10
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 3e-10
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 3e-10
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 3e-10
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 3e-10
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 4e-10
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 7e-10
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 1e-09
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 1e-09
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 1e-09
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-09
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 3e-09
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 4e-09
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 4e-09
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 7e-09
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 8e-09
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 8e-09
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 9e-09
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 1e-08
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 1e-08
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 1e-08
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 1e-08
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 1e-08
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 1e-08
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 1e-08
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 1e-08
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 1e-08
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-08
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 1e-08
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 1e-08
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 1e-08
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 2e-08
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-08
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 2e-08
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 2e-08
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 2e-08
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 2e-08
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 2e-08
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 3e-08
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 3e-08
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-08
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 3e-08
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-08
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 3e-08
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-08
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 3e-08
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 3e-08
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 3e-08
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-08
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-08
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 3e-08
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 3e-08
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 3e-08
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-08
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 3e-08
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 3e-08
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 3e-08
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 3e-08
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 3e-08
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 3e-08
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 3e-08
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 3e-08
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 3e-08
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 3e-08
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 3e-08
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 3e-08
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 3e-08
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 3e-08
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 3e-08
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 3e-08
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 4e-08
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 4e-08
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 4e-08
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 4e-08
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 4e-08
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 4e-08
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 4e-08
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 4e-08
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 4e-08
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 4e-08
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 4e-08
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 4e-08
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 4e-08
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 4e-08
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 4e-08
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 4e-08
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 5e-08
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 5e-08
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 5e-08
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 5e-08
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 5e-08
4fst_A269 Crystal Structure Of The Chk1 Length = 269 5e-08
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 5e-08
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 5e-08
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 6e-08
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 6e-08
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 6e-08
3lxn_A318 Structural And Thermodynamic Characterization Of Th 6e-08
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 8e-08
3lxk_A327 Structural And Thermodynamic Characterization Of Th 1e-07
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 1e-07
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-07
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 1e-07
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 1e-07
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-07
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 1e-07
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 1e-07
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 1e-07
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 2e-07
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 2e-07
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 2e-07
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 2e-07
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 2e-07
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 2e-07
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 2e-07
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 2e-07
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 2e-07
4fl3_A635 Structural And Biophysical Characterization Of The 2e-07
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-07
4fl2_A636 Structural And Biophysical Characterization Of The 3e-07
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 3e-07
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 4e-07
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 4e-07
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 4e-07
3g2f_A336 Crystal Structure Of The Kinase Domain Of Bone Morp 4e-07
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 4e-07
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 8e-07
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 9e-07
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 9e-07
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-06
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 1e-06
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 1e-06
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 1e-06
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 1e-06
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 1e-06
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-06
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 1e-06
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-06
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-06
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 2e-06
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 2e-06
3a7f_A303 Human Mst3 Kinase Length = 303 2e-06
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 2e-06
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 2e-06
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 2e-06
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 2e-06
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 2e-06
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 2e-06
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 3e-06
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 3e-06
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 3e-06
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 4e-06
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 4e-06
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-06
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 4e-06
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-06
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 5e-06
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 5e-06
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 5e-06
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 5e-06
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 5e-06
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 5e-06
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 6e-06
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 6e-06
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 7e-06
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 7e-06
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 8e-06
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 8e-06
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 8e-06
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 8e-06
1rjb_A344 Crystal Structure Of Flt3 Length = 344 8e-06
3kmw_A271 Crystal Structure Of The IlkALPHA-Parvin Core Compl 9e-06
2qlu_A314 Crystal Structure Of Activin Receptor Type Ii Kinas 9e-06
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 9e-06
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 1e-05
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-05
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 1e-05
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 1e-05
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 1e-05
3mdy_A337 Crystal Structure Of The Cytoplasmic Domain Of The 1e-05
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 1e-05
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 1e-05
1b6c_B342 Crystal Structure Of The Cytoplasmic Domain Of The 1e-05
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 1e-05
1py5_A326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 2e-05
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 2e-05
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 2e-05
1rw8_A301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 2e-05
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 2e-05
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-05
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 2e-05
2wot_A306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 2e-05
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 2e-05
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-05
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 2e-05
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-05
1vjy_A303 Crystal Structure Of A Naphthyridine Inhibitor Of H 2e-05
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 2e-05
3tzm_A309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 2e-05
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 2e-05
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 2e-05
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-05
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 2e-05
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-05
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-05
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-05
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 3e-05
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 3e-05
4hzs_A341 Crystal Structure Of Ack1 Kinase Domain With C-term 3e-05
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 3e-05
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 3e-05
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 3e-05
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 3e-05
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 3e-05
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 3e-05
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 3e-05
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 3e-05
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 4e-05
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 5e-05
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 5e-05
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 5e-05
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 5e-05
4fie_A423 Full-Length Human Pak4 Length = 423 5e-05
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 6e-05
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 6e-05
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-05
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-05
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 6e-05
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 6e-05
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 6e-05
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 6e-05
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 7e-05
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 7e-05
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 7e-05
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 9e-05
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 9e-05
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 9e-05
3my0_A305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 9e-05
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 1e-04
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-04
3nyn_A 576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-04
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-04
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-04
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 1e-04
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 1e-04
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-04
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 2e-04
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 2e-04
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 2e-04
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 2e-04
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 2e-04
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 2e-04
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-04
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 3e-04
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 3e-04
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-04
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 3e-04
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 3e-04
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 3e-04
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 3e-04
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 4e-04
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 4e-04
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-04
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 4e-04
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 4e-04
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-04
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 4e-04
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 4e-04
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 5e-04
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 5e-04
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 5e-04
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 5e-04
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 5e-04
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 5e-04
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 6e-04
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 6e-04
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 6e-04
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 6e-04
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 6e-04
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 6e-04
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 6e-04
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 6e-04
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 6e-04
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 6e-04
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 7e-04
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 7e-04
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 7e-04
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 7e-04
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 7e-04
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 7e-04
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 7e-04
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 8e-04
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 8e-04
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 8e-04
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 8e-04
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 9e-04
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 9e-04
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure

Iteration: 1

Score = 157 bits (397), Expect = 1e-38, Method: Compositional matrix adjust. Identities = 103/293 (35%), Positives = 151/293 (51%), Gaps = 6/293 (2%) Query: 69 EARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQ---EFID 125 E+ R + +L AT NF K LIG G FG+VYKG+L+DG VA+K+R +Q EF Sbjct: 25 ESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFET 84 Query: 126 EVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLS 185 E+ L+ +H +LV+L+G+C E N LIY+Y+ NG++ HLYG S + + ++ RL Sbjct: 85 EIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYG-SDLPTMSMSWEQRLE 143 Query: 186 IXXXXXXXXXXXXXXXPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQV 245 I ++H+D K+ N+L+DE+F+ K+ D G+ D V Sbjct: 144 ICIGAARGLHYLHTRA--IIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLXXVV 201 Query: 246 TADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREAXXXXXXXXXXXXVELVQNSRD 305 ++ E R +EKSDVYSFGV L E++ R A E S + Sbjct: 202 KGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHN 261 Query: 306 FSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTL 358 L +I+D L E + +F V+CL SSE RPSM DV+ +L+ L Sbjct: 262 NGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKLEYAL 314
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3KMW|A Chain A, Crystal Structure Of The IlkALPHA-Parvin Core Complex (Mgatp) Length = 271 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query386
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-102
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 1e-96
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 2e-88
3soc_A322 Activin receptor type-2A; structural genomics cons 6e-69
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-57
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 7e-57
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 3e-56
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 3e-56
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 4e-54
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 5e-54
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 1e-52
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-51
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-50
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-50
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 2e-50
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 3e-50
3q4u_A301 Activin receptor type-1; structural genomics conso 1e-49
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-48
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 9e-42
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-41
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 7e-40
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-39
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-39
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 8e-39
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-38
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 2e-38
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 4e-38
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 5e-38
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-38
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-37
3lzb_A327 Epidermal growth factor receptor; epidermal growth 2e-37
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 3e-37
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 5e-37
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 1e-36
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-36
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 2e-36
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-36
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 8e-36
3poz_A327 Epidermal growth factor receptor; kinase domain, a 9e-36
3pls_A298 Macrophage-stimulating protein receptor; protein k 1e-35
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 1e-35
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 2e-35
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-35
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 4e-35
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 4e-35
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 9e-35
4aoj_A329 High affinity nerve growth factor receptor; transf 1e-34
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 2e-34
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-34
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 7e-34
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 9e-34
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 9e-34
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 1e-33
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 1e-33
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-33
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 3e-33
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 7e-33
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 9e-33
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-32
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 2e-32
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 2e-32
2xir_A316 Vascular endothelial growth factor receptor 2; ang 3e-32
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 3e-32
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 4e-32
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 6e-32
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 6e-32
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 9e-32
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 1e-31
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-31
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 6e-31
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 6e-31
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-30
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 6e-30
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 9e-29
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 1e-28
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-28
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-28
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-27
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-27
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-26
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 1e-25
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 5e-25
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-24
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-24
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 4e-24
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 7e-24
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 1e-23
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 2e-23
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 6e-23
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 8e-23
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-22
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-22
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-22
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-22
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 4e-22
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 4e-22
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-21
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 5e-21
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 9e-21
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 1e-20
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-20
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-20
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 2e-20
3aln_A327 Dual specificity mitogen-activated protein kinase; 1e-19
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 1e-19
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-19
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-19
3eqc_A360 Dual specificity mitogen-activated protein kinase; 4e-19
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-19
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 1e-18
3niz_A311 Rhodanese family protein; structural genomics, str 2e-18
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-18
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 5e-18
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-18
3an0_A340 Dual specificity mitogen-activated protein kinase; 1e-17
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 1e-17
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-17
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 2e-17
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-17
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 3e-17
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 3e-17
3fme_A290 Dual specificity mitogen-activated protein kinase; 3e-17
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 4e-17
3ork_A311 Serine/threonine protein kinase; structural genomi 4e-17
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 5e-17
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 5e-17
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 7e-17
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-16
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 1e-16
3uqc_A286 Probable conserved transmembrane protein; structur 1e-16
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-16
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 1e-16
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 2e-16
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-16
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-16
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 4e-16
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 4e-16
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 4e-05
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 7e-16
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 1e-15
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-15
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-15
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-15
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 4e-15
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 9e-15
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 1e-14
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 2e-14
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-14
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-14
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-14
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-14
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 4e-14
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 5e-14
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 5e-14
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 5e-14
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 6e-14
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 7e-14
3bhy_A283 Death-associated protein kinase 3; death associate 8e-14
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 9e-14
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-13
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 1e-13
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-13
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 2e-13
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 2e-13
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 2e-13
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 3e-13
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 4e-13
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 5e-13
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 5e-13
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 5e-13
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 5e-13
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 5e-13
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 6e-13
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 6e-13
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 7e-13
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 1e-12
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 3e-12
3dls_A335 PAS domain-containing serine/threonine-protein KI; 5e-12
3rp9_A458 Mitogen-activated protein kinase; structural genom 6e-12
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 8e-12
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 9e-12
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 2e-11
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-11
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 4e-11
2fst_X367 Mitogen-activated protein kinase 14; active mutant 6e-11
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 7e-11
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 9e-11
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-10
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 1e-10
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 1e-10
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-10
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 6e-10
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 8e-10
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 1e-09
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 6e-09
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 6e-09
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 7e-09
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 8e-09
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-08
2eue_A275 Carbon catabolite derepressing protein kinase; kin 2e-08
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-08
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 2e-08
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 3e-08
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-08
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 3e-07
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-06
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-06
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 5e-06
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 5e-06
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 7e-06
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 8e-06
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 2e-05
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 3e-05
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 4e-05
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 7e-05
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 1e-04
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 1e-04
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 1e-04
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-04
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-04
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 3e-04
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 5e-04
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 5e-04
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 6e-04
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 7e-04
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 8e-04
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 8e-04
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 8e-04
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
 Score =  304 bits (780), Expect = e-102
 Identities = 112/292 (38%), Positives = 167/292 (57%), Gaps = 12/292 (4%)

Query: 69  EARRFQMEELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPGAPTQ---EFID 125
           E+ R  + +L  AT NF  K LIG G FG+VYKG+L+DG  VA+K+R    +Q   EF  
Sbjct: 25  ESYRVPLVDLEEATNNFDHKFLIGHGVFGKVYKGVLRDGAKVALKRRTPESSQGIEEFET 84

Query: 126 EVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLS 185
           E+  L+  +H +LV+L+G+C E N   LIY+Y+ NG++  HLYG        + ++ RL 
Sbjct: 85  EIETLSFCRHPHLVSLIGFCDERNEMILIYKYMENGNLKRHLYGSDL-PTMSMSWEQRLE 143

Query: 186 IALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGL-RNF--LGRTDVAGPS 242
           I +GAA+GL +LH+    ++H+D K+ N+L+DE+F+ K+ D G+ +    L +T +   S
Sbjct: 144 ICIGAARGLHYLHT--RAIIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHL---S 198

Query: 243 SQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQN 302
           + V     ++  E     R +EKSDVYSFGV L E++  R A     P    +L E    
Sbjct: 199 TVVKGTLGYIDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVE 258

Query: 303 SRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTEL 354
           S +   L +I+D  L      E + +F    V+CL  SSE RPSM DV+ +L
Sbjct: 259 SHNNGQLEQIVDPNLADKIRPESLRKFGDTAVKCLALSSEDRPSMGDVLWKL 310


>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query386
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 100.0
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
3uqc_A286 Probable conserved transmembrane protein; structur 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.97
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.95
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.92
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.82
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.71
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 99.34
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 99.27
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 99.15
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 98.93
3r70_A320 Aminoglycoside phosphotransferase; structural geno 98.68
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 98.52
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 98.51
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 98.4
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 98.34
3ats_A357 Putative uncharacterized protein; hypothetical pro 98.28
2q83_A346 YTAA protein; 2635576, structural genomics, joint 98.17
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 97.88
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 97.86
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.74
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 97.57
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 97.57
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 97.33
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 97.27
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 97.21
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 97.13
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 97.13
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 97.03
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 96.9
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 96.66
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 96.57
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 96.4
3f2s_A401 CK, chetk-alpha, choline kinase alpha; non-protein 95.91
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 95.9
2k1k_A38 Ephrin type-A receptor 1; EPHA1, receptor tyrosine 95.89
3mes_A424 Choline kinase; malaria, structural genomics, stru 95.65
2l8s_A54 Integrin alpha-1; transmembrane region, detergent 94.38
2knc_A54 Integrin alpha-IIB; transmembrane signaling, prote 94.24
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 93.21
2k9y_A41 Ephrin type-A receptor 2; receptor tyrosine kinase 92.93
2k1a_A42 Integrin alpha-IIB; single-PASS transmembrane segm 91.54
2l34_A33 TYRO protein tyrosine kinase-binding protein; immu 90.19
2klu_A70 T-cell surface glycoprotein CD4; cell membrane, di 90.17
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 89.96
4ann_A215 ESSB; membrane protein, membrane secretion, ESS ty 89.23
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 89.18
2knc_B79 Integrin beta-3; transmembrane signaling, protein 83.82
2lx0_A32 Membrane fusion protein P14; membrane fusion prote 83.0
4ano_A219 ESSB; membrane protein, membrane secretion, ESS ty 82.9
2k9j_B43 Integrin beta-3; transmembrane complex, cell adhes 82.65
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 80.67
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.3e-59  Score=436.46  Aligned_cols=262  Identities=26%  Similarity=0.428  Sum_probs=209.0

Q ss_pred             hcCCCcCCeecccCceEEEEEEeC------CCcEEEEEECCCCC---hhHHHHHHHHHHcCCCCcccccccceeeCCeEE
Q 016588           82 TKNFSDKNLIGEGKFGEVYKGLLQ------DGMLVAIKKRPGAP---TQEFIDEVCFLASIQHRNLVTLLGYCQENNLQF  152 (386)
Q Consensus        82 ~~~~~~~~~lg~G~~g~V~~~~~~------~~~~vavK~~~~~~---~~~~~~e~~~l~~l~h~niv~~~~~~~~~~~~~  152 (386)
                      .++|.+.+.||+|+||+||+|.++      ++..||||+++...   .++|.+|+++|++++|||||+++|+|.+.+..|
T Consensus        40 ~~d~~l~~~LG~G~fG~Vy~a~~~~~~~~~~~~~vAvK~l~~~~~~~~~~f~~E~~il~~l~HpnIV~l~g~~~~~~~~~  119 (329)
T 4aoj_A           40 RRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLL  119 (329)
T ss_dssp             GGGEEEEEEEEECSSEEEEEEEESSSCC---CEEEEEEEESCCSHHHHHHHHHHHHHHTTCCCTTBCCEEEEECSSSSEE
T ss_pred             HHHeEEEEEEccCCCcEEEEEEECCcccCCCCeEEEEEEECcCCHHHHHHHHHHHHHHHhCCCCCCCcEEEEEEECCEEE
Confidence            346777789999999999999864      36789999976544   346899999999999999999999999999999


Q ss_pred             EEEEeecCCCccccccCCCc----------CCCCCCCHHHHHHHHHHHHHHHHHhhcCCCCceecCCCCCCeeeCCCCce
Q 016588          153 LIYEYIPNGSVSIHLYGPSQ----------VSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIA  222 (386)
Q Consensus       153 lv~e~~~~g~L~~~l~~~~~----------~~~~~l~~~~~~~i~~~i~~~l~~LH~~~~~ivH~dlkp~Nill~~~~~~  222 (386)
                      +|||||++|+|.+++.....          .....+++..++.++.|++.||.|||+  ++|+||||||+||||+.++.+
T Consensus       120 lV~Ey~~~G~L~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~qia~gl~yLH~--~~iiHRDLKp~NILl~~~~~~  197 (329)
T 4aoj_A          120 MVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAG--LHFVHRDLATRNCLVGQGLVV  197 (329)
T ss_dssp             EEEECCTTCBHHHHHHTSSCC-----------CCSCCHHHHHHHHHHHHHHHHHHHH--TTCCCSCCCGGGEEEETTTEE
T ss_pred             EEEEcCCCCcHHHHHHhcCcccccccccccccCCCCCHHHHHHHHHHHHHHHHHHhc--CCeecccccHhhEEECCCCcE
Confidence            99999999999999864321          123568999999999999999999999  779999999999999999999


Q ss_pred             EEcccccccccCCCCCCCCCccccCcccccchhhhcccCCCcccchhhHHHHHHHHHc-CCCCCCCCCCCchhhHHHHHH
Q 016588          223 KVADAGLRNFLGRTDVAGPSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVS-GREASSSLSPDSSQDLVELVQ  301 (386)
Q Consensus       223 kl~DFgl~~~~~~~~~~~~~~~~~~~~~y~aPE~~~~~~~~~~~DvwSlGvil~el~t-g~~p~~~~~~~~~~~~~~~~~  301 (386)
                      ||+|||+++...............+|+.|||||++.+..|+.++|||||||++|||+| |+.||.....   .+....+.
T Consensus       198 Ki~DFGla~~~~~~~~~~~~~~~~gt~~ymAPE~~~~~~~~~~sDvwS~Gvvl~Ellt~G~~Pf~~~~~---~~~~~~i~  274 (329)
T 4aoj_A          198 KIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSN---TEAIDCIT  274 (329)
T ss_dssp             EECCCC----------------CCCCGGGCCHHHHTTCCCCHHHHHHHHHHHHHHHHTTSCCTTCSSCH---HHHHHHHH
T ss_pred             EEcccccceeccCCCcceecCcccccccccChhhhcCCCCCccccccchHHHHHHHHcCCCCCCCCCCH---HHHHHHHH
Confidence            9999999997755444444455678999999999999999999999999999999999 8999987542   22222221


Q ss_pred             hhhcccchhhhcchhhcccCCHHHHHHHHHHHhHccCCCCCCCCCHHHHHHHHHHhhhhh
Q 016588          302 NSRDFSNLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDKE  361 (386)
Q Consensus       302 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~li~~cl~~dp~~Rpt~~evl~~L~~~~~~~  361 (386)
                      .             ..+...+..+++++.+|+.+||+.||++|||+.||+++|+.+.+..
T Consensus       275 ~-------------g~~~~~p~~~~~~~~~li~~cl~~dP~~RPs~~ei~~~L~~l~~~p  321 (329)
T 4aoj_A          275 Q-------------GRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAP  321 (329)
T ss_dssp             H-------------TCCCCCCTTCCHHHHHHHHHHCCSSTTTSCCHHHHHHHHHHHHHSC
T ss_pred             c-------------CCCCCCcccccHHHHHHHHHHcCcChhHCcCHHHHHHHHHHHhhCC
Confidence            1             1122345556778999999999999999999999999999988653



>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A Back     alignment and structure
>3mes_A Choline kinase; malaria, structural genomics, structural genomics consortium, SGC, transferase; HET: ADP DME PT3; 2.35A {Cryptosporidium parvum} Back     alignment and structure
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens} Back     alignment and structure
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2k9y_A Ephrin type-A receptor 2; receptor tyrosine kinase, membrane protein, dimeric transmembrane domain, ephrin receptor, ATP-binding, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A Back     alignment and structure
>2l34_A TYRO protein tyrosine kinase-binding protein; immunoreceptor, transmembrane assembly, DAP12, protein bindi; NMR {Homo sapiens} PDB: 2l35_B Back     alignment and structure
>2klu_A T-cell surface glycoprotein CD4; cell membrane, disulfide bond, HOST- virus interaction, immune response, immunoglobulin domain, lipoprotein; NMR {Homo sapiens} Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>4ann_A ESSB; membrane protein, membrane secretion, ESS type VII secretion virulence; 1.05A {Staphylococcus aureus subsp} Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2lx0_A Membrane fusion protein P14; membrane fusion protein transmembrane domain, P14 fast prote ARCH, micelle-peptide complex, membrane protein; NMR {Synthetic} Back     alignment and structure
>4ano_A ESSB; membrane protein, membrane secretion, ESS type V secretion S; HET: MSE; 1.70A {Geobacillus thermodenitrificans ng80-2organism_taxid} Back     alignment and structure
>2k9j_B Integrin beta-3; transmembrane complex, cell adhesion, cleavage on basic residues, disease mutation, glycoprotein, pyrrolidone carboxylic acid; NMR {Homo sapiens} PDB: 2rmz_A 2rn0_A 2l91_A Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 386
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-58
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-56
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-56
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-54
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 7e-54
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-53
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-53
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-51
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-51
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-51
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-51
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 3e-51
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 2e-50
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 4e-50
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 8e-50
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-49
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 4e-49
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 5e-48
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-47
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 2e-47
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 5e-47
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 6e-47
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 7e-47
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-46
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-46
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 5e-46
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 5e-46
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-45
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-45
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 1e-44
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-43
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-42
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 5e-41
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-40
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-40
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-39
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-38
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-37
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-37
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-37
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 5e-37
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-36
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 2e-36
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-36
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-36
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 3e-35
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-35
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-34
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-34
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 5e-34
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-33
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-31
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-31
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 8e-31
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-30
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-30
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-27
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-27
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-27
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 1e-26
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 3e-24
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 9e-24
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 8e-17
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  189 bits (482), Expect = 1e-58
 Identities = 71/289 (24%), Positives = 130/289 (44%), Gaps = 28/289 (9%)

Query: 76  EELSLATKNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKK-RPGAPT----QEFIDEVCFL 130
           ++  +     +    IG G FG VYKG       VA+K     APT    Q F +EV  L
Sbjct: 1   DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQAFKNEVGVL 58

Query: 131 ASIQHRNLVTLLGYCQENNLQFLIYEYIPNGSVSIHLYGPSQVSRQKLEFKHRLSIALGA 190
              +H N++  +GY     L  ++ ++    S+  HL+        K E    + IA   
Sbjct: 59  RKTRHVNILLFMGYSTAPQL-AIVTQWCEGSSLYHHLHII----ETKFEMIKLIDIARQT 113

Query: 191 AKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAGPSSQVTADEI 250
           A+G+ +LH+    ++H+D K+ N+ + ED   K+ D GL     R   +    Q++   +
Sbjct: 114 AQGMDYLHA--KSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSIL 171

Query: 251 FLASEV---KEFRRFSEKSDVYSFGVFLLELVSGREASSSLSPDSSQDLVELVQNSRDFS 307
           ++A EV   ++   +S +SDVY+FG+ L EL++G+   S+++      ++ +V       
Sbjct: 172 WMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINN--RDQIIFMVGRGYLSP 229

Query: 308 NLLKILDERLWSTFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDR 356
           +L K+              +   +L+  CL    + RP    ++  ++ 
Sbjct: 230 DLSKVRSNCP---------KAMKRLMAECLKKKRDERPLFPQILASIEL 269


>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query386
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.91
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.41
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.31
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.59
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 97.07
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 96.9
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 96.69
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Tyrosine-protein kinase Itk/Tsk
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.5e-57  Score=406.02  Aligned_cols=255  Identities=27%  Similarity=0.426  Sum_probs=202.5

Q ss_pred             cCCCcCCeecccCceEEEEEEeCCCcEEEEEECCC--CChhHHHHHHHHHHcCCCCcccccccceeeCCeEEEEEEeecC
Q 016588           83 KNFSDKNLIGEGKFGEVYKGLLQDGMLVAIKKRPG--APTQEFIDEVCFLASIQHRNLVTLLGYCQENNLQFLIYEYIPN  160 (386)
Q Consensus        83 ~~~~~~~~lg~G~~g~V~~~~~~~~~~vavK~~~~--~~~~~~~~e~~~l~~l~h~niv~~~~~~~~~~~~~lv~e~~~~  160 (386)
                      ++|+..+.||+|+||+||+|.+.+++.||||++..  ...+++.+|+++++.++||||++++|++...+..++||||+++
T Consensus         5 ~~~~~~~~iG~G~fg~Vy~~~~~~~~~vAvK~i~~~~~~~~~~~~E~~~l~~l~HpnIv~~~g~~~~~~~~~lv~E~~~~   84 (263)
T d1sm2a_           5 SELTFVQEIGSGQFGLVHLGYWLNKDKVAIKTIREGAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEH   84 (263)
T ss_dssp             SCEEEEEEEECCSSCCEEEEEETTTEEEEEEECCSSSSCHHHHHHHHHHHHHCCCTTBCCEEEEECSSSSCEEEEECCTT
T ss_pred             HHcEEEEEEeeCCCeEEEEEEECCCCEEEEEEECCCcCcHHHHHHHHHHHHhcCCCCcccccceeccCCceEEEEEecCC
Confidence            57888899999999999999998888999998654  3456799999999999999999999999999999999999999


Q ss_pred             CCccccccCCCcCCCCCCCHHHHHHHHHHHHHHHHHhhcCCCCceecCCCCCCeeeCCCCceEEcccccccccCCCCCCC
Q 016588          161 GSVSIHLYGPSQVSRQKLEFKHRLSIALGAAKGLAHLHSLSPRVVHKDFKTANVLVDEDFIAKVADAGLRNFLGRTDVAG  240 (386)
Q Consensus       161 g~L~~~l~~~~~~~~~~l~~~~~~~i~~~i~~~l~~LH~~~~~ivH~dlkp~Nill~~~~~~kl~DFgl~~~~~~~~~~~  240 (386)
                      |+|.+++..    ....+++..+..++.|++.||.|||+  ++|+||||||+|||++.++.+||+|||+++....... .
T Consensus        85 g~L~~~l~~----~~~~~~~~~~~~i~~qia~gl~~lH~--~~iiHrDlKp~Nill~~~~~~Kl~DFGla~~~~~~~~-~  157 (263)
T d1sm2a_          85 GCLSDYLRT----QRGLFAAETLLGMCLDVCEGMAYLEE--ACVIHRDLAARNCLVGENQVIKVSDFGMTRFVLDDQY-T  157 (263)
T ss_dssp             CBHHHHHHT----TTTCCCHHHHHHHHHHHHHHHHHHHH--TTCCCTTCSGGGEEECGGGCEEECSCC------------
T ss_pred             CcHHHHhhc----cccCCCHHHHHHHHHHHHHHHHhhhc--cceeecccchhheeecCCCCeEecccchheeccCCCc-e
Confidence            999998753    34568899999999999999999999  7799999999999999999999999999987754322 2


Q ss_pred             CCccccCcccccchhhhcccCCCcccchhhHHHHHHHHHcCCC-CCCCCCCCchhhHHHHHHhhhcccchhhhcchhhcc
Q 016588          241 PSSQVTADEIFLASEVKEFRRFSEKSDVYSFGVFLLELVSGRE-ASSSLSPDSSQDLVELVQNSRDFSNLLKILDERLWS  319 (386)
Q Consensus       241 ~~~~~~~~~~y~aPE~~~~~~~~~~~DvwSlGvil~el~tg~~-p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  319 (386)
                      ......+|..|+|||++.+..|+.++|||||||++|||+|+.. |+....   .......+..             ..+.
T Consensus       158 ~~~~~~gt~~y~aPE~l~~~~~~~k~DVwS~Gvil~el~t~~~~~~~~~~---~~~~~~~i~~-------------~~~~  221 (263)
T d1sm2a_         158 SSTGTKFPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRS---NSEVVEDIST-------------GFRL  221 (263)
T ss_dssp             -------CTTSCCHHHHTTCCCCHHHHHHHHHHHHHHHHTTSCCTTCSCC---HHHHHHHHHH-------------TCCC
T ss_pred             eecceecCcccCChHHhcCCCCCchhhhcchHHHHHHHHHCCCCCCCCCC---HHHHHHHHHh-------------cCCC
Confidence            2334568889999999999999999999999999999999654 444322   2222222221             1122


Q ss_pred             cCCHHHHHHHHHHHhHccCCCCCCCCCHHHHHHHHHHhhhh
Q 016588          320 TFTNEGMEEFIQLIVRCLDPSSERRPSMSDVVTELDRTLDK  360 (386)
Q Consensus       320 ~~~~~~~~~l~~li~~cl~~dp~~Rpt~~evl~~L~~~~~~  360 (386)
                      ..+..+++++.+++.+||+.||++|||++|++++|+++++.
T Consensus       222 ~~p~~~~~~l~~li~~cl~~~p~~Rps~~~il~~L~~i~es  262 (263)
T d1sm2a_         222 YKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAES  262 (263)
T ss_dssp             CCCTTSCHHHHHHHHHHTCSSGGGSCCHHHHHHHHHHHHHH
T ss_pred             CCccccCHHHHHHHHHHccCCHhHCcCHHHHHHHHHHHHhC
Confidence            33344567799999999999999999999999999998764



>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure