Citrus Sinensis ID: 016592


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MESRVLSRATTTTTTISSLRRSPLENHQNVSFISLKPIGAVGEGGNVIWGRQLRPALLLESSNAPAGLFAGKKEILRPILATASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNKISTQTGIGTVIAIAGVAAYSYIKAQMEEEKRQMKAA
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
****************************************************************************************************FFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNKISTQTGIGTVIAIAGVAAYSYIK*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESRVLSRATTTTTTISSLRRSPLENHQNVSFISLKPIGAVGEGGNVIWGRQLRPALLLESSNAPAGLFAGKKEILRPILATASSPAEGSDSAGEAAPVRFFDRYPALVTGFFFFMWYFLNVIFNILNKRIYNYFPYPYFVSVIHLLVGVVYCLVSWAVGLPKRAPIDSKLLKLLIPVAVCHALGHVTSNVSFAAVAVSFTHTIKALEPFFNAAASQFILGQQLPLTLWLSLAPVVIGVSMASLTELSFNWTGFISAMISNISFTYRSIYSKKAMVEGPQLIKHGLSDAISKVGMVKFISDLFWVGMFYHLYNQLATNTLERVAPLTHAVGNVLKRVFVIGFSILAFGNKISTQTGIGTVIAIAGVAAYSYIKAQMEEEKRQMKAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Triose phosphate/phosphate translocator TPT, chloroplastic Triose phosphate/phosphate translocator that transports inorganic phosphate, 3-phosphoglycerate (3-PGA) and triose phosphate. Functions in the export of photoassimilates from chloroplasts during the day. In the light, triose phosphates are exported from the chloroplast stroma in counter exchange with inorganic phosphate (Pi), generated during sucrose biosynthesis in the cytosol. Involved in photosynthetic acclimation, a light response resulting in increased tolerance to high-intensity light.confidentQ9ZSR7
Triose phosphate/phosphate translocator TPT, chloroplastic Triose phosphate/phosphate translocator that may function in the export of photoassimilates from chloroplasts during the day.confidentQ9FTT3
Triose phosphate/phosphate translocator, chloroplastic Mediates the export of fixed carbons from the chloroplasts into the cytosol in the form of triose phosphates.probableP11869

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 254-271,299-372
View the alignment between query and template
View the model in PyMOL
Template: 3B5D, chain A
Confidence level:probable
Coverage over the Query: 176-246
View the alignment between query and template
View the model in PyMOL