Citrus Sinensis ID: 016593


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MEVLGMEEGKKPEDHMTSAAAFVEGGIQDSCDDACSICLEEFSESDPSTVTSCKHEFHLQCVLEWCQRSSQCPMCWQPISLKDATSQELLEAVEQERSIRANPPRNATIFHHPTFGDFELQHLPVGASDTDLEEHILQHLTAAAAMGRAHHFGRRESHRNRSAAHGRPHFFVFSAHPGGAPPGAVAQGGGTEPAPLAGASPSVPLSSSGNDSSQHMLQFHPIQTNQNSSSASGSAVAQATRRGFSFNNRSTSSQTSSPTHDRAGPSDLQSFSESLKSRFNAVSMRYKESISKSTRGWKERLFSRNASMPGTGSENRSENVGITSVSRLMEQLGTGESTRGSEASVSSHMANPLVTEQNSENNTETRGENPVNNETPPSCAASSFSR
ccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccHHHHcccccccccccHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
*****************************SCDDACSICLEEFSESDPSTVTSCKHEFHLQCVLEWCQRSSQCPMCWQPISLKD***********************ATIFHHPTFGDFELQHLPVGASDTDLEEHILQHLTAAAAMG**********************FFVF*********************************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVLGMEEGKKPEDHMTSAAAFVEGGIQDSCDDACSICLEEFSESDPSTVTSCKHEFHLQCVLEWCQRSSQCPMCWQPISLKDATSQELLEAVEQERSIRANPPRNATIFHHPTFGDFELQHLPVGASDTDLEEHILQHLTAAAAMGRAHHFGRRESHRNRSAAHGRPHFFVFSAHPGGAPPGAVAQGGGTEPAPLAGASPSVPLSSSGNDSSQHMLQFHPIQTNQNSSSASGSAVAQATRRGFSFNNRSTSSQTSSPTHDRAGPSDLQSFSESLKSRFNAVSMRYKESISKSTRGWKERLFSRNASMPGTGSENRSENVGITSVSRLMEQLGTGESTRGSEASVSSHMANPLVTEQNSENNTETRGENPVNNETPPSCAASSFSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase RHF2A Probable E3 ubiquitin-protein ligase involved in the positive regulation of the gametogenesis progression. Required for the degradation of KRP6, a cyclin-dependent kinase inhibitor which accumulates during meiosis and blocks the progression of subsequent mitoses during gametophytes development. Functions in association with RHF1A.probableQ9ZT42

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AP4, chain A
Confidence level:very confident
Coverage over the Query: 30-84
View the alignment between query and template
View the model in PyMOL
Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 32-110
View the alignment between query and template
View the model in PyMOL