Citrus Sinensis ID: 016633


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MACFRSAKHPFRIFFYNRLSAATNSKYGYSTCASKGTPVYQARQIKDLFSFKYLNPKSSFALISRNFSDQAPAATEQVNLIKQLREQTSAPMKDVKLALVDCDWDIEAALKELRKRGKVLASKKSSRTATEGLLALAQNESKAAVIELNCETDFVSRNEIFQYLALALAKQALVAENVSQPVSGLFPVGPEYLEGLKLNLDHPKIGGETTVQNAITEVAAIMGENVKLRRGFLLSASSPGVVSTYLHTSPQSGLGRIAGLLSLEVEDGSSSFDPLKRVGSELAMHIVAQKPLFLTKELVSADALENEREILKSQAESTGKSPMAIEKMVEGRLRKYYEEVVLMEQKFVMNDTLNIKTILDNLSKEVGSPVKIGSFFRMEVGEGIRR
ccccccccccHHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHHHcHHHHHHHHcccccccEEEEEEcccEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHcccEEEEEEEEEECccccEEEEEEccccccccccEEEEEEEECccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcccccccccEEEEEEEEEccccccc
******AKHPFRIFFYNRLSAA*********CASKGTPVYQARQIKDLFSFKYLNPKSSFALISRNFSDQAPAATEQVNLIKQLREQTSAPMKDVKLALVDCDWDIEAALKELRKRGKVLASKKSSRTATEGLLALAQNESKAAVIELNCETDFVSRNEIFQYLALALAKQALVAENVSQPVSGLFPVGPEYLEGLKLNLDHPKIGGETTVQNAITEVAAIMGENVKLRRGFLLSASSPGVVSTYLHTSPQSGLGRIAGLLSLEVEDGSSSFDPLKRVGSELAMHIVAQKPLFLTKELVSADALENERE*L************AIEKMVEGRLRKYYEEVVLMEQKFVMNDTLNIKTILDNLSKEVGSPVKIGSFFRMEVGEGIR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MACFRSAKHPFRIFFYNRLSAATNSKYGYSTCASKGTPVYQARQIKDLFSFKYLNPKSSFALISRNFSDQAPAATEQVNLIKQLREQTSAPMKDVKLALVDCDWDIEAALKELRKRGKVLASKKSSRTATEGLLALAQNESKAAVIELNCETDFVSRNEIFQYLALALAKQALVAENVSQPVSGLFPVGPEYLEGLKLNLDHPKIGGETTVQNAITEVAAIMGENVKLRRGFLLSASSPGVVSTYLHTSPQSGLGRIAGLLSLEVEDGSSSFDPLKRVGSELAMHIVAQKPLFLTKELVSxxxxxxxxxxxxxxxxxxxxxPMAIEKMVEGRLRKYYEEVVLMEQKFVMNDTLNIKTILDNLSKEVGSPVKIGSFFRMEVGEGIRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor Ts, mitochondrial Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.probableQ6ZJS7
Elongation factor Ts, mitochondrial Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.probableQ5XF75
Elongation factor Ts, mitochondrial Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis stage on the ribosome.probableB9SEZ6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AIP, chain C
Confidence level:very confident
Coverage over the Query: 76-164,279-381
View the alignment between query and template
View the model in PyMOL
Template: 1XB2, chain B
Confidence level:very confident
Coverage over the Query: 77-299,317-318,335-383
View the alignment between query and template
View the model in PyMOL