BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016642
(385 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2DVT|A Chain A, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
From Rhizobium
pdb|2DVT|B Chain B, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
From Rhizobium
pdb|2DVT|C Chain C, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
From Rhizobium
pdb|2DVT|D Chain D, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
From Rhizobium
pdb|2DVU|A Chain A, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With 2,6-Dihydroxybenzoate
pdb|2DVU|B Chain B, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With 2,6-Dihydroxybenzoate
pdb|2DVU|C Chain C, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With 2,6-Dihydroxybenzoate
pdb|2DVU|D Chain D, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With 2,6-Dihydroxybenzoate
pdb|2DVX|A Chain A, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
pdb|2DVX|B Chain B, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
pdb|2DVX|C Chain C, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
pdb|2DVX|D Chain D, Crystal Structure Of 2,6-Dihydroxybenzoate Decarboxylase
Complexed With Inhibitor 2,3-Dihydroxybenzaldehyde
Length = 327
Score = 36.2 bits (82), Expect = 0.029, Method: Compositional matrix adjust.
Identities = 25/85 (29%), Positives = 36/85 (42%), Gaps = 19/85 (22%)
Query: 76 WFFWPLYWVAQGTMFWAIFVLGHDCGHGSFSESPLLNSFVGHILHSSILVPYNGWRISHR 135
W P + AQ T A+ ++ G F E P LN +GH+ +PY WRI HR
Sbjct: 181 WLLGPTWAFAQETAVHALRLMAS----GLFDEHPRLNIILGHMGEG---LPYMMWRIDHR 233
Query: 136 THHQNHGNVEHDESWVPMPEKIYSK 160
+WV +P + +K
Sbjct: 234 N------------AWVKLPPRYPAK 246
>pdb|3S4T|A Chain A, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
pdb|3S4T|B Chain B, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
pdb|3S4T|C Chain C, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
pdb|3S4T|D Chain D, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
pdb|3S4T|E Chain E, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
pdb|3S4T|F Chain F, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
pdb|3S4T|G Chain G, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
pdb|3S4T|H Chain H, Crystal Structure Of Putative Amidohydrolase-2 (Efi-Target
500288)from Polaromonas Sp. Js666
Length = 348
Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 19/62 (30%), Positives = 26/62 (41%), Gaps = 7/62 (11%)
Query: 75 TWFFWPLYWVAQGTMFWAIFVLGHDCGHGSFSESPLLNSFVGHILHSSILVPYNGWRISH 134
W P + Q T A+ + G G F + P L +GH +PY+ WRI H
Sbjct: 180 AWLLGPTWAFGQETAVHALRL----XGSGLFDKYPALKIILGHXGEG---LPYSXWRIDH 232
Query: 135 RT 136
R
Sbjct: 233 RN 234
>pdb|1KQF|C Chain C, Formate Dehydrogenase N From E. Coli
pdb|1KQG|C Chain C, Formate Dehydrogenase N From E. Coli
Length = 217
Score = 28.5 bits (62), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 16/63 (25%), Positives = 36/63 (57%), Gaps = 5/63 (7%)
Query: 211 VISTACWTFMFGLLVYLSFVFGPITMFKL----YGVPYLIFVMWLDFVTYLHHHGDDEHK 266
+++ + +F F L +L+ FG M ++ +G+ + +M++ FV ++HH+ D+
Sbjct: 27 LVALSGISFFFPTLQWLTQTFGTPQMGRILHPFFGIAIFVALMFM-FVRFVHHNIPDKKD 85
Query: 267 LPW 269
+PW
Sbjct: 86 IPW 88
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.141 0.477
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 12,957,344
Number of Sequences: 62578
Number of extensions: 552772
Number of successful extensions: 952
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 951
Number of HSP's gapped (non-prelim): 5
length of query: 385
length of database: 14,973,337
effective HSP length: 101
effective length of query: 284
effective length of database: 8,652,959
effective search space: 2457440356
effective search space used: 2457440356
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 52 (24.6 bits)