Citrus Sinensis ID: 016652


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-----
MRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLLMNSRDPSVVPFVEELQSRILCHYQATKSQEINGEDSNWTNLYDLEAPQSRTSSPQNFSGGFPQFEDENEERKEDGKQSLENRDGSKVLPFEFVALEACLEAACSCLENEAKTLEQEAHPALDKLTSKISTLNLERVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLMQQLENSSTSSINERDDMDDEVLQSNMNNRHLKFCFFFVNCLFIFFPSMRLNLLSCFRTTAEISLEATGGSTSYEADFQNTENIHDNLFTQNIHSRASHGTRTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTVRNSISPLNFGLLPLLEQLIW
ccccccccccccccccccccccCEEEcccEEEEEccccEEEEEcccEEECcccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcc
****GLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLLMNSRDPSVVPFVEELQSRILC****************************************************************KVLPFEFVALEACLEAACSCLENEAKTLEQEAHPALDKLTSKISTLNLERVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLMQ**********************************F*******F*******************************************************************HLDVEELEMLLEAYFVQIDGTLNKLSTVRNSISPLNFGLLPLLEQLIW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRTGLPARDLRILDPLLSYPSTVLGRERAIVINLEHIKAIITAQEVLLMNSRDPSVVPFVEELQSRILCHYQATKSQEINGEDSNWTNLYDLEAPQSRTSSPQNFSGGFPQFEDENEERKEDGKQSLENRDGSKVLPFEFVALxxxxxxxxxxxxxxxxxxxxxAHPALDKLTSKISTLNLERVRQIKSRLVAITGRVQKVRDELEHLLDDDEDMAEMYLTEKLMQQLENSSTSSINERDDMDDEVLQSNMNNRHLKFCFFFVNCLFIFFPSMRLNLLSCFRTTAEISLEATGGSTSYEADFQNTENIHDNLFTQNIHSRASHGTRTSTTHSAISKHLDVEELEMLLEAYFVQIDGTLNKLSTVRNSISPLNFGLLPLLEQLIW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Magnesium transporter MRS2-3 Magnesium transporter that may mediate the influx of magnesium.probableQ9LJN2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RKG, chain A
Confidence level:very confident
Coverage over the Query: 1-72,134-226,337-377
View the alignment between query and template
View the model in PyMOL