Citrus Sinensis ID: 016695


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MNERVRRACANCCADFVYGFFENSSKKGGEYWLIWRYEGEATLADLMISREFPYNVQTLILGEVQDLPKGIERENRIIQTIMSQLLFALDGLHSTGIVHRDIKPQNVIFSEGSRTFKIIDLGAAADLRVGINYIPKEFLLDPRYAAPEQYIMSTQTPSAPSAPVATALSPVLWQLNLPDRFDIYSAGLIFLQMAFPGLRTDSGLIQFNRQLKRCDYDLSAWRKTVEPRASPDLRKGFQLLDIDGGIGWELLTSMVRYKARQRISAKTALAHPYFDREGLLALSFMQNLRLQFFRATQQDYSEAAEWVIQRMAKSGTEKEGGFTEAQLQELREIKPLRKGSAQRNALASALKLQRRIVRTLNESMDEFNIRQKSLWWSRWIPREE
ccHHHHHHHccccccccccCEEccccccccEEEEEEEcccccHHHHHccccccEEEHHcccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHcccHHHHHccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHccccccHHHHHHHcccccccccccccccccccccHHHHHHHHcccccccccccHHHHHcccccccccccHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccc
*****R*ACANCCADFVYGFFENSSKKGGEYWLIWRYEGEATLADLMISREFPYNVQTLILGEVQDLPKGIERENRIIQTIMSQLLFALDGLHSTGIVHRDIKPQNVIFSEGSRTFKIIDLGAAADLRVGINYIPKEFLLDPRYAAPEQYIMSTQTPSAPSAPVATALSPVLWQLNLPDRFDIYSAGLIFLQMAFPGLRTDSGLIQFNRQLKRCDYDLSAWRKTVEPRASPDLRKGFQLLDIDGGIGWELLTSMVRYKARQRISAKTALAHPYFDREGLLALSFMQNLRLQFFRATQQDYSEAAEWVIQR**************************************ALKLQRRIVRTLNESMDEFNIRQKSLWWSRWIPR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNERVRRACANCCADFVYGFFENSSKKGGEYWLIWRYEGEATLADLMISREFPYNVQTLILGEVQDLPKGIERENRIIQTIMSQLLFALDGLHSTGIVHRDIKPQNVIFSEGSRTFKIIDLGAAADLRVGINYIPKEFLLDPRYAAPEQYIMSTQTPSAPSAPVATALSPVLWQLNLPDRFDIYSAGLIFLQMAFPGLRTDSGLIQFNRQLKRCDYDLSAWRKTVEPRASPDLRKGFQLLDIDGGIGWELLTSMVRYKARQRISAKTALAHPYFDREGLLALSFMQNLRLQFFRATQQDYSEAAEWVIQRMAKSGTEKEGGFTEAQLQELREIKPLRKGSAQRNALASALKLQRRIVRTLNESMDEFNIRQKSLWWSRWIPREE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase STN7, chloroplastic Serine/threonine protein kinase required for state transition by phosphorylating light-harvesting complex II outer antennae (LCHII). State transition plays a central role in response to environmental changes and allows to adjust to changing light conditions via the redistribution of light excitation energy between photosystem II (PSII) and photosystem I (PSI). Phosphorylates the minor light harvesting protein LHCB4.2/CP29 and is involved in the light-dependent phosphorylation of TSP9. Acts as a key component of the long-term response (LTR) signaling pathway.probableQ9S713

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LIJ, chain A
Confidence level:very confident
Coverage over the Query: 5-51,72-152,176-229,244-331
View the alignment between query and template
View the model in PyMOL
Template: 4E7W, chain A
Confidence level:very confident
Coverage over the Query: 4-51,68-154,176-278
View the alignment between query and template
View the model in PyMOL
Template: 3NIE, chain A
Confidence level:probable
Coverage over the Query: 78-124,157-274
View the alignment between query and template
View the model in PyMOL
Template: 3HX4, chain A
Confidence level:probable
Coverage over the Query: 17-59,76-148,172-227,247-361
View the alignment between query and template
View the model in PyMOL