Citrus Sinensis ID: 016698


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MEGVRVKEEETVTYAATTATAASASSSSSSSNFMPQPLEGLHDAGPPPFLTKTYEMVEDLSTDAIVSWSRTRNSFIVWDSHQFSTTLLPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRHVSQSMQQRGGEACLEVGQYGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLAQSNAHRRELGGVQTGRKRRLTATPSMENLQETISVAPVGLDCGPVVDYTVQDQNELTSMETEIETFLSSPVDNESSSDIDNPNAGSVPAPSGGNFSSVNETIWEDFMADDLIAGDPEEVVVKDQSEAEVELEDLVATPTDWGEELQDLVDQMGYLR
cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccEEEccccccEEECccHHHHHHHHccccccccHHHHHHHHHccccEEcccccCEECccccccccHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHccccc
************************************************FLTKTYEMVEDLSTDAIVSWSRTRNSFIVWDSHQFSTTLLPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKR*********************YGLDGELERLKRDRNVLMAEIVRLRQHQQQSRDQLSAME*******KKQQQMMTFLAKAL************************************************************************************************************NETIWEDFMADDLIA*******************DLVATPTDWGEELQDLVDQMGYL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGVRVKEEETVTYAATTATAASASSSSSSSNFMPQPLEGLHDAGPPPFLTKTYEMVEDLSTDAIVSWSRTRNSFIVWDSHQFSTTLLPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLGGQKHLLKTIKRRRHVSQSMQQRGGEACLEVGQYGLDGExxxxxxxxxxxxxxxxxxxxxQQQSRDQLSAMEDRLLSTEKKQQQMMTFLAKALKNPSFFQQLAQSNAHRRELGGVQTGRKRRLTATPSMENLQETISVAPVGLDCGPVVDYTVQDQNELTSMETEIETFLSSPVDNESSSDIDNPNAGSVPAPSGGNFSSVNETIWEDFMADDLIAGDPEEVVVKDQSEAEVELEDLVATPTDWGEELQDLVDQMGYLR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat stress transcription factor A-2 Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress responses. Seems to be involved in other environmental stress responses. Activates ascorbate peroxidase 2 (APX2) in addition to several heat shock protein (HSPs).probableO80982
Heat shock factor protein HSF30 DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription.probableP41152
Heat stress transcription factor A-2b Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).probableQ6VBB2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LDU, chain A
Confidence level:very confident
Coverage over the Query: 44-141
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 161-211
View the alignment between query and template
View the model in PyMOL