BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016720
         (384 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HTG|A Chain A, Porphobilinogen Deaminase From Arabidopsis Thaliana
          Length = 320

 Score = 35.8 bits (81), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 8/57 (14%)

Query: 224 LHIEVIRTWGTRVVGMTLLVIGAMGI--KEASEVPTPCVALENGECDVSVYEALDNP 278
           +HIE+I+T G +++   L  IG  G+  KE  E      AL NG  D++V+   D P
Sbjct: 47  IHIEIIKTTGDKILSQPLADIGGKGLFTKEIDE------ALINGHIDIAVHSMKDVP 97


>pdb|4HTY|A Chain A, Crystal Structure Of A Metagenome-Derived Cellulase Cel5a
 pdb|4HU0|A Chain A, Crystal Structure Of A Metagenome-Derived Cellulase Cel5a
           In Complex With Cellotetraose
          Length = 359

 Score = 30.0 bits (66), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 223 RLHIEVIRTWGTRVVGMTL--LVIGAMGIKEASEVPTPCVALENGECDVSVYEALDNPAV 280
           + H EVIR+WG  VV + +        G+K   E+    VA  N   ++ +Y  LD  ++
Sbjct: 88  KKHFEVIRSWGANVVRVPVHPRAWKERGVKGYLELLDQVVAWNN---ELGIYTILDWHSI 144

Query: 281 GKKK 284
           G  K
Sbjct: 145 GNLK 148


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.135    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,312,133
Number of Sequences: 62578
Number of extensions: 314120
Number of successful extensions: 416
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 415
Number of HSP's gapped (non-prelim): 3
length of query: 384
length of database: 14,973,337
effective HSP length: 101
effective length of query: 283
effective length of database: 8,652,959
effective search space: 2448787397
effective search space used: 2448787397
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)