BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016727
         (384 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q3SIN5|GRPE_THIDA Protein GrpE OS=Thiobacillus denitrificans (strain ATCC 25259)
           GN=grpE PE=3 SV=1
          Length = 173

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%)

Query: 296 EDIDMTVRLVINCNGMKVNAVKDVFEKSLRARLEKVNHLAYGITLVFLQISLTHGTF 352
           ED+D   +  +     ++ AVKD  E +L A    V++L  G+TL   Q+S   G F
Sbjct: 58  EDVDKARKFAVESFAGELLAVKDSLEAALAAESPSVDNLKDGVTLTLKQLSAVFGKF 114


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.135    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 134,452,128
Number of Sequences: 539616
Number of extensions: 5169169
Number of successful extensions: 12169
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 12166
Number of HSP's gapped (non-prelim): 11
length of query: 384
length of database: 191,569,459
effective HSP length: 119
effective length of query: 265
effective length of database: 127,355,155
effective search space: 33749116075
effective search space used: 33749116075
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)