BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 016727
(384 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q3SIN5|GRPE_THIDA Protein GrpE OS=Thiobacillus denitrificans (strain ATCC 25259)
GN=grpE PE=3 SV=1
Length = 173
Score = 36.2 bits (82), Expect = 0.43, Method: Compositional matrix adjust.
Identities = 19/57 (33%), Positives = 29/57 (50%)
Query: 296 EDIDMTVRLVINCNGMKVNAVKDVFEKSLRARLEKVNHLAYGITLVFLQISLTHGTF 352
ED+D + + ++ AVKD E +L A V++L G+TL Q+S G F
Sbjct: 58 EDVDKARKFAVESFAGELLAVKDSLEAALAAESPSVDNLKDGVTLTLKQLSAVFGKF 114
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.321 0.135 0.401
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 134,452,128
Number of Sequences: 539616
Number of extensions: 5169169
Number of successful extensions: 12169
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 12166
Number of HSP's gapped (non-prelim): 11
length of query: 384
length of database: 191,569,459
effective HSP length: 119
effective length of query: 265
effective length of database: 127,355,155
effective search space: 33749116075
effective search space used: 33749116075
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)