BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016775
         (383 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1S72|P Chain P, Refined Crystal Structure Of The Haloarcula Marismortui
           Large Ribosomal Subunit At 2.4 Angstrom Resolution
 pdb|1YHQ|P Chain P, Crystal Structure Of Azithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YI2|P Chain P, Crystal Structure Of Erythromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIJ|P Chain P, Crystal Structure Of Telithromycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YIT|P Chain P, Crystal Structure Of Virginiamycin M And S Bound To The
           50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJ9|P Chain P, Crystal Structure Of The Mutant 50s Ribosomal Subunit Of
           Haloarcula Marismortui Containing A Three Residue
           Deletion In L22
 pdb|1YJN|P Chain P, Crystal Structure Of Clindamycin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1YJW|P Chain P, Crystal Structure Of Quinupristin Bound To The G2099a
           Mutant 50s Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ4|P Chain P, The Structure Of The Transition State Analogue "daa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ5|P Chain P, The Structure Of The Transition State Analogue "raa" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ6|P Chain P, The Structure Of C-Hpmn And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ7|P Chain P, The Structure Of The Transition State Analogue "dca" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQ8|P Chain P, The Structure Of Ccda-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQ9|P Chain P, The Structure Of Cca-Phe-Cap-Bio And The Antibiotic
           Sparsomycin Bound To The Large Ribosomal Subunit Of
           Haloarcula Marismortui
 pdb|1VQK|P Chain P, The Structure Of Ccda-Phe-Cap-Bio Bound To The A Site Of
           The Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQL|P Chain P, The Structure Of The Transition State Analogue "dcsn"
           Bound To The Large Ribosomal Subunit Of Haloarcula
           Marismortui
 pdb|1VQM|P Chain P, The Structure Of The Transition State Analogue "dan" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQN|P Chain P, The Structure Of Cc-hpmn And Cca-phe-cap-bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|1VQO|P Chain P, The Structure Of Ccpmn Bound To The Large Ribosomal
           Subunit Haloarcula Marismortui
 pdb|1VQP|P Chain P, The Structure Of The Transition State Analogue "rap" Bound
           To The Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2OTJ|P Chain P, 13-Deoxytedanolide Bound To The Large Subunit Of
           Haloarcula Marismortui
 pdb|2OTL|P Chain P, Girodazole Bound To The Large Subunit Of Haloarcula
           Marismortui
 pdb|2QA4|P Chain P, A More Complete Structure Of The The L7L12 STALK OF THE
           Haloarcula Marismortui 50s Large Ribosomal Subunit
 pdb|3CC2|P Chain P, The Refined Crystal Structure Of The Haloarcula
           Marismortui Large Ribosomal Subunit At 2.4 Angstrom
           Resolution With Rrna Sequence For The 23s Rrna And
           Genome-Derived Sequences For R-Proteins
 pdb|3CC4|P Chain P, Co-Crystal Structure Of Anisomycin Bound To The 50s
           Ribosomal Subunit
 pdb|3CC7|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2487u
 pdb|3CCE|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535a
 pdb|3CCJ|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation C2534u
 pdb|3CCL|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation U2535c. Density For Anisomycin Is
           Visible But Not Included In Model.
 pdb|3CCM|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2611u
 pdb|3CCQ|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488u
 pdb|3CCR|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation A2488c. Density For Anisomycin Is
           Visible But Not Included In The Model.
 pdb|3CCS|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482a
 pdb|3CCU|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2482c
 pdb|3CCV|P Chain P, Structure Of Anisomycin Resistant 50s Ribosomal Subunit:
           23s Rrna Mutation G2616a
 pdb|3CD6|P Chain P, Co-cystal Of Large Ribosomal Subunit Mutant G2616a With
           Cc-puromycin
 pdb|3CPW|O Chain O, The Structure Of The Antibiotic Linezolid Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CMA|P Chain P, The Structure Of Cca And Cca-Phe-Cap-Bio Bound To The
           Large Ribosomal Subunit Of Haloarcula Marismortui
 pdb|3CME|P Chain P, The Structure Of Ca And Cca-Phe-Cap-Bio Bound To The Large
           Ribosomal Subunit Of Haloarcula Marismortui
 pdb|2QEX|P Chain P, Negamycin Binds To The Wall Of The Nascent Chain Exit
           Tunnel Of The 50s Ribosomal Subunit
 pdb|3I55|P Chain P, Co-Crystal Structure Of Mycalamide A Bound To The Large
           Ribosomal Subunit
 pdb|3I56|P Chain P, Co-Crystal Structure Of Triacetyloleandomcyin Bound To The
           Large Ribosomal Subunit
 pdb|4ADX|P Chain P, The Cryo-Em Structure Of The Archaeal 50s Ribosomal
           Subunit In Complex With Initiation Factor 6
          Length = 149

 Score = 30.8 bits (68), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 16/78 (20%)

Query: 319 EAITQFD-KELL------AKNR-GNAMLRYKEKKKNRSYGKQIRYESRKARADTRK---- 366
           +AIT+ D +EL+      AK++ GN+  R +E++K R+YG Q    SRK +A  R+    
Sbjct: 34  DAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKE 93

Query: 367 ----RVKGRFVKASEISD 380
               R++ +  K  E+ D
Sbjct: 94  DWESRIRAQRTKLRELRD 111


>pdb|3G4S|P Chain P, Co-Crystal Structure Of Tiamulin Bound To The Large
           Ribosomal Subunit
 pdb|3G6E|P Chain P, Co-Crystal Structure Of Homoharringtonine Bound To The
           Large Ribosomal Subunit
 pdb|3G71|P Chain P, Co-crystal Structure Of Bruceantin Bound To The Large
           Ribosomal Subunit
          Length = 143

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 16/78 (20%)

Query: 319 EAITQFD-KELL------AKNR-GNAMLRYKEKKKNRSYGKQIRYESRKARADTRK---- 366
           +AIT+ D +EL+      AK++ GN+  R +E++K R+YG Q    SRK +A  R+    
Sbjct: 33  DAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKE 92

Query: 367 ----RVKGRFVKASEISD 380
               R++ +  K  E+ D
Sbjct: 93  DWESRIRAQRTKLRELRD 110


>pdb|1R8W|A Chain A, Native Structure Of The B12-Independent Glycerol
           Dehydratase From Clostridium Butyricum
 pdb|1R8W|B Chain B, Native Structure Of The B12-Independent Glycerol
           Dehydratase From Clostridium Butyricum
 pdb|1R9D|A Chain A, Glycerol Bound Form Of The B12-Independent Glycerol
           Dehydratase From Clostridium Butyricum
 pdb|1R9D|B Chain B, Glycerol Bound Form Of The B12-Independent Glycerol
           Dehydratase From Clostridium Butyricum
 pdb|1R9E|A Chain A, Structure Of The B12-Independent Glycerol Dehydratase With
           1,2-Propanediol Bound
 pdb|1R9E|B Chain B, Structure Of The B12-Independent Glycerol Dehydratase With
           1,2-Propanediol Bound
          Length = 787

 Score = 28.9 bits (63), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 29/67 (43%), Gaps = 8/67 (11%)

Query: 151 NCSVFMSGNKYKKEVYEQLVEIGKRDLVRFNGNGAELGPGTTTSICDQYGYTQSLEVENI 210
           NC VF  GN Y   V    V+ GK   V FN        G      +Q    +S++ + I
Sbjct: 148 NCDVFTVGNYYYNGVGHVSVDYGKVLRVGFN--------GIINEAKEQLEKNRSIDPDFI 199

Query: 211 DEEKLLN 217
            +EK LN
Sbjct: 200 KKEKFLN 206


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.404 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,525,083
Number of Sequences: 62578
Number of extensions: 467982
Number of successful extensions: 959
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 954
Number of HSP's gapped (non-prelim): 7
length of query: 383
length of database: 14,973,337
effective HSP length: 101
effective length of query: 282
effective length of database: 8,652,959
effective search space: 2440134438
effective search space used: 2440134438
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)