BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 016826
         (382 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2WNS|A Chain A, Human Orotate Phosphoribosyltransferase (Oprtase) Domain
           Of Uridine 5'-Monophosphate Synthase (Umps) In Complex
           With Its Substrate Orotidine 5'-Monophosphate (Omp)
 pdb|2WNS|B Chain B, Human Orotate Phosphoribosyltransferase (Oprtase) Domain
           Of Uridine 5'-Monophosphate Synthase (Umps) In Complex
           With Its Substrate Orotidine 5'-Monophosphate (Omp)
          Length = 205

 Score = 30.0 bits (66), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 36/81 (44%), Gaps = 16/81 (19%)

Query: 133 LQAISFSDFFLADILTSMAKVFSDLERSVCR-MVHRQVATI-------AWFEADSVCGSH 184
           +QA  F DF L   L+S   ++ DL   V R  +  QVA I       A    D+VCG  
Sbjct: 13  VQAFKFGDFVLKSGLSS--PIYIDLRGIVSRPRLLSQVADILFQTAQNAGISFDTVCGVP 70

Query: 185 SVAIPLVLV------LPYLFR 199
             A+PL  V      +P L R
Sbjct: 71  YTALPLATVICSTNQIPMLIR 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.138    0.457 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,777,947
Number of Sequences: 62578
Number of extensions: 405685
Number of successful extensions: 893
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 893
Number of HSP's gapped (non-prelim): 1
length of query: 382
length of database: 14,973,337
effective HSP length: 101
effective length of query: 281
effective length of database: 8,652,959
effective search space: 2431481479
effective search space used: 2431481479
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 52 (24.6 bits)